BLASTX nr result
ID: Akebia27_contig00036652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036652 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR62047.1| putative glycoside hydrolase family 17 protein [E... 58 1e-06 >gb|EMR62047.1| putative glycoside hydrolase family 17 protein [Eutypa lata UCREL1] Length = 588 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 5/50 (10%) Frame = +3 Query: 207 IHHRHVHGAVPELLKKSP-----TNESETCGCTTIYSTYYGEATLSIPKP 341 +HHRH H L KK+ TN +E CGCTTIYSTYYGEATL P P Sbjct: 22 LHHRHGHEVFHGLAKKNYPTGGLTNGTEECGCTTIYSTYYGEATLHNPPP 71