BLASTX nr result
ID: Akebia27_contig00036620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036620 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051318.1| Tetratricopeptide repeat-like superfamily pr... 77 3e-12 ref|XP_004496036.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_003519723.2| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 >ref|XP_007051318.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508703579|gb|EOX95475.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 686 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = +3 Query: 150 NLFDKNLFTHLRSPTNLFEARRLHGLLVVRGFFHSTSTDVLVLCSQLVNIYVCFDCLQEA 329 NL +LF+ L+SP+NL +A+RLH LL+V G F+ ++TD VL SQLVN+YV F CLQ A Sbjct: 68 NLLRSSLFSQLKSPSNLSDAKRLHALLIVNGLFNPSNTD-RVLGSQLVNVYVTFGCLQYA 126 Query: 330 LLVFNQL 350 L VF+QL Sbjct: 127 LFVFDQL 133 >ref|XP_004496036.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cicer arietinum] Length = 736 Score = 67.4 bits (163), Expect = 2e-09 Identities = 39/71 (54%), Positives = 44/71 (61%) Frame = +3 Query: 138 HTKPNLFDKNLFTHLRSPTNLFEARRLHGLLVVRGFFHSTSTDVLVLCSQLVNIYVCFDC 317 H+ P F +LF L SP NL EA+RLH LL+V GFFH TS L SQLVN+YV F Sbjct: 56 HSLPIFFITSLFHQLNSPPNLLEAKRLHALLLVLGFFHPTSPH-KSLPSQLVNVYVNFGS 114 Query: 318 LQEALLVFNQL 350 L A L F QL Sbjct: 115 LHYAFLSFTQL 125 >ref|XP_003519723.2| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 754 Score = 65.1 bits (157), Expect = 1e-08 Identities = 38/85 (44%), Positives = 44/85 (51%) Frame = +3 Query: 96 SQAISSPDTHQESHHTKPNLFDKNLFTHLRSPTNLFEARRLHGLLVVRGFFHSTSTDVLV 275 + AI+ T H+ P F F L+SP NL EAR LH LL+V GFF T Sbjct: 36 AHAIAMLITFTRQQHSLPIHFTVTSFHRLKSPPNLHEARTLHALLLVLGFFQPTCPHSSS 95 Query: 276 LCSQLVNIYVCFDCLQEALLVFNQL 350 SQLVN+YV F LQ A L F L Sbjct: 96 FASQLVNVYVNFGSLQHAFLTFRAL 120