BLASTX nr result
ID: Akebia27_contig00036579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036579 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208300.1| hypothetical protein PRUPE_ppa003246mg [Prun... 65 8e-09 gb|EYU36010.1| hypothetical protein MIMGU_mgv1a002796mg [Mimulus... 65 1e-08 ref|XP_007015617.1| Tetratricopeptide repeat (TPR)-like superfam... 64 3e-08 ref|XP_004295136.1| PREDICTED: outer envelope protein 61, chloro... 64 3e-08 ref|XP_002515855.1| fk506 binding protein, putative [Ricinus com... 63 5e-08 ref|XP_006384688.1| tetratricopeptide repeat-containing family p... 62 1e-07 ref|XP_004506250.1| PREDICTED: outer envelope protein 61, chloro... 61 1e-07 emb|CBI24398.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002272729.1| PREDICTED: outer envelope protein 61, chloro... 61 1e-07 ref|XP_002312880.1| tetratricopeptide repeat-containing family p... 61 1e-07 emb|CAN64899.1| hypothetical protein VITISV_041976 [Vitis vinifera] 61 1e-07 gb|EXB39675.1| Outer envelope protein 61 [Morus notabilis] 60 2e-07 ref|XP_006421086.1| hypothetical protein CICLE_v10004601mg [Citr... 60 2e-07 ref|XP_006487134.1| PREDICTED: outer envelope protein 61, chloro... 60 4e-07 ref|XP_006487133.1| PREDICTED: outer envelope protein 61, chloro... 60 4e-07 ref|XP_003527506.1| PREDICTED: outer envelope protein 61, chloro... 60 4e-07 ref|XP_006592367.1| PREDICTED: outer envelope protein 61, chloro... 59 5e-07 ref|XP_006592366.1| PREDICTED: outer envelope protein 61, chloro... 59 5e-07 ref|XP_002461492.1| hypothetical protein SORBIDRAFT_02g003490 [S... 59 5e-07 ref|XP_004955506.1| PREDICTED: outer envelope protein 61, chloro... 59 7e-07 >ref|XP_007208300.1| hypothetical protein PRUPE_ppa003246mg [Prunus persica] gi|462403942|gb|EMJ09499.1| hypothetical protein PRUPE_ppa003246mg [Prunus persica] Length = 589 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI EGSEVL YDA+NVKALYRRGQAYKE Sbjct: 162 KQYDECINEGSEVLAYDANNVKALYRRGQAYKE 194 >gb|EYU36010.1| hypothetical protein MIMGU_mgv1a002796mg [Mimulus guttatus] Length = 637 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDEC+TEG+EVL YDA NVKALYRRGQAYKE Sbjct: 160 KQYDECVTEGTEVLAYDAKNVKALYRRGQAYKE 192 >ref|XP_007015617.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508785980|gb|EOY33236.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 581 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 +QYDECI EGSEVL YDA NVKALYRRGQAYKE Sbjct: 160 RQYDECIKEGSEVLSYDAKNVKALYRRGQAYKE 192 >ref|XP_004295136.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 627 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 +QYDECI EGSEVL YDA NVKALYRRGQAYKE Sbjct: 162 RQYDECIKEGSEVLAYDAQNVKALYRRGQAYKE 194 >ref|XP_002515855.1| fk506 binding protein, putative [Ricinus communis] gi|223545010|gb|EEF46524.1| fk506 binding protein, putative [Ricinus communis] Length = 595 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 +QYDECI EGSEVL YDA NVKALYRRGQAYKE Sbjct: 160 RQYDECIKEGSEVLGYDAKNVKALYRRGQAYKE 192 >ref|XP_006384688.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|550341456|gb|ERP62485.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 559 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQY+ECI EGSEVL YDA+NVKALYRRGQAY+E Sbjct: 160 KQYNECIKEGSEVLGYDANNVKALYRRGQAYRE 192 >ref|XP_004506250.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Cicer arietinum] Length = 601 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 4 QYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 QYDECI EGSEVL YDA N+KALYRRGQAYKE Sbjct: 161 QYDECIKEGSEVLAYDAKNLKALYRRGQAYKE 192 >emb|CBI24398.3| unnamed protein product [Vitis vinifera] Length = 584 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI EG+EVL YD NVKALYRRGQAYKE Sbjct: 155 KQYDECIQEGTEVLAYDPKNVKALYRRGQAYKE 187 >ref|XP_002272729.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Vitis vinifera] Length = 590 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI EG+EVL YD NVKALYRRGQAYKE Sbjct: 161 KQYDECIQEGTEVLAYDPKNVKALYRRGQAYKE 193 >ref|XP_002312880.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|222849288|gb|EEE86835.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 588 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI EGSEVL YDA N KALYRRGQAY+E Sbjct: 160 KQYDECIKEGSEVLGYDAKNAKALYRRGQAYRE 192 >emb|CAN64899.1| hypothetical protein VITISV_041976 [Vitis vinifera] Length = 709 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI EG+EVL YD NVKALYRRGQAYKE Sbjct: 161 KQYDECIQEGTEVLAYDPKNVKALYRRGQAYKE 193 >gb|EXB39675.1| Outer envelope protein 61 [Morus notabilis] Length = 595 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI EGSEVL YD N+KALYRRGQAYK+ Sbjct: 158 KQYDECIKEGSEVLAYDVKNLKALYRRGQAYKD 190 >ref|XP_006421086.1| hypothetical protein CICLE_v10004601mg [Citrus clementina] gi|557522959|gb|ESR34326.1| hypothetical protein CICLE_v10004601mg [Citrus clementina] Length = 591 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 KQYDECI GSEVL YDA NVKALYRRGQAYK+ Sbjct: 160 KQYDECIKVGSEVLAYDAKNVKALYRRGQAYKD 192 >ref|XP_006487134.1| PREDICTED: outer envelope protein 61, chloroplastic-like isoform X2 [Citrus sinensis] Length = 559 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYK 96 KQYDECI GSEVL YDA NVKALYRRGQAYK Sbjct: 128 KQYDECIKVGSEVLAYDAKNVKALYRRGQAYK 159 >ref|XP_006487133.1| PREDICTED: outer envelope protein 61, chloroplastic-like isoform X1 [Citrus sinensis] Length = 591 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYK 96 KQYDECI GSEVL YDA NVKALYRRGQAYK Sbjct: 160 KQYDECIKVGSEVLAYDAKNVKALYRRGQAYK 191 >ref|XP_003527506.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Glycine max] Length = 581 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 KQYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 +QY+EC+ EGSEVL YDA N+KALYRRGQAYKE Sbjct: 160 RQYNECVKEGSEVLAYDAKNLKALYRRGQAYKE 192 >ref|XP_006592367.1| PREDICTED: outer envelope protein 61, chloroplastic-like isoform X2 [Glycine max] Length = 580 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 4 QYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 QY+ECI EGSEVL YDA N+KALYRRGQAYKE Sbjct: 161 QYNECIKEGSEVLAYDAKNLKALYRRGQAYKE 192 >ref|XP_006592366.1| PREDICTED: outer envelope protein 61, chloroplastic-like isoform X1 [Glycine max] Length = 582 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 4 QYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 QY+ECI EGSEVL YDA N+KALYRRGQAYKE Sbjct: 161 QYNECIKEGSEVLAYDAKNLKALYRRGQAYKE 192 >ref|XP_002461492.1| hypothetical protein SORBIDRAFT_02g003490 [Sorghum bicolor] gi|241924869|gb|EER98013.1| hypothetical protein SORBIDRAFT_02g003490 [Sorghum bicolor] Length = 559 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 4 QYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 Q+DECI+EGSEVL YD++NVKA YRRGQAYKE Sbjct: 157 QFDECISEGSEVLTYDSNNVKAYYRRGQAYKE 188 >ref|XP_004955506.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Setaria italica] Length = 553 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 4 QYDECITEGSEVLQYDADNVKALYRRGQAYKE 99 Q+DECI+EGSEVL YD+ NVKA YRRGQAYKE Sbjct: 157 QFDECISEGSEVLTYDSSNVKAYYRRGQAYKE 188