BLASTX nr result
ID: Akebia27_contig00036521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036521 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830102.1| hypothetical protein AMTR_s05231p00006790, p... 50 7e-06 >ref|XP_006830102.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] gi|548835948|gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] Length = 77 Score = 50.1 bits (118), Expect(2) = 7e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 196 TNARQSHEPPIHSHPIMVGEQVKIKKLTLDLG 291 T +RQSHEP IHSH I GEQVKI+KLTL LG Sbjct: 34 TPSRQSHEPLIHSHSITAGEQVKIEKLTLGLG 65 Score = 25.4 bits (54), Expect(2) = 7e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 267 KKTHIGFRIIRLELMTST 320 +K +G IIRLELMTST Sbjct: 58 EKLTLGLGIIRLELMTST 75