BLASTX nr result
ID: Akebia27_contig00036213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036213 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005645039.1| hypothetical protein COCSUDRAFT_54336 [Cocco... 56 5e-06 >ref|XP_005645039.1| hypothetical protein COCSUDRAFT_54336 [Coccomyxa subellipsoidea C-169] gi|384247007|gb|EIE20495.1| hypothetical protein COCSUDRAFT_54336 [Coccomyxa subellipsoidea C-169] Length = 199 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 87 IVYIGITLTRTGIYYLHKLGIFYYLTRAGAVSALPAHLMSDHV 215 +VY+GITL R +Y LH G++ L+RAGAVSA+P LMSDH+ Sbjct: 66 VVYVGITLVRIFVYGLHCAGVYRLLSRAGAVSAVPIQLMSDHI 108