BLASTX nr result
ID: Akebia27_contig00036151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036151 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282760.1| PREDICTED: protein arginine N-methyltransfer... 63 4e-08 emb|CBI27942.3| unnamed protein product [Vitis vinifera] 63 4e-08 gb|ACE82047.1| putative protein arginine N-methyltransferase 1 [... 62 6e-08 ref|XP_007012896.1| Arginine methyltransferase 11 [Theobroma cac... 62 8e-08 ref|XP_002883976.1| hypothetical protein ARALYDRAFT_343233 [Arab... 62 1e-07 ref|XP_006412834.1| hypothetical protein EUTSA_v100269450mg, par... 61 1e-07 ref|XP_002309219.2| hypothetical protein POPTR_0006s15380g, part... 61 1e-07 gb|AAO32061.1| putative arginine methyltransferase [Brassica rap... 61 1e-07 gb|EXB38812.1| Protein arginine N-methyltransferase 1.1 [Morus n... 61 2e-07 ref|XP_006661156.1| PREDICTED: probable protein arginine N-methy... 60 2e-07 ref|XP_006298196.1| hypothetical protein CARUB_v10014243mg [Caps... 60 2e-07 ref|XP_006285816.1| hypothetical protein CARUB_v10007292mg [Caps... 60 2e-07 dbj|BAD23315.1| putative protein-arginine N-methyltransferase [O... 60 2e-07 ref|XP_003529075.1| PREDICTED: probable protein arginine N-methy... 60 2e-07 ref|XP_002869429.1| hypothetical protein ARALYDRAFT_491807 [Arab... 60 2e-07 gb|ACU24230.1| unknown [Glycine max] 60 2e-07 ref|XP_002514159.1| protein arginine n-methyltransferase 1, puta... 60 2e-07 gb|EAZ44443.1| hypothetical protein OsJ_29056 [Oryza sativa Japo... 60 2e-07 ref|NP_001062975.1| Os09g0359800 [Oryza sativa Japonica Group] g... 60 2e-07 ref|XP_006451413.1| hypothetical protein CICLE_v10008497mg [Citr... 60 3e-07 >ref|XP_002282760.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Vitis vinifera] Length = 406 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +N G+VLPDKASLYLTAIEDAEYKEDKIEFW Sbjct: 221 VNDGIVLPDKASLYLTAIEDAEYKEDKIEFW 251 >emb|CBI27942.3| unnamed protein product [Vitis vinifera] Length = 350 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +N G+VLPDKASLYLTAIEDAEYKEDKIEFW Sbjct: 165 VNDGIVLPDKASLYLTAIEDAEYKEDKIEFW 195 >gb|ACE82047.1| putative protein arginine N-methyltransferase 1 [Musa acuminata AAA Group] Length = 385 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 NGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 N G+VLPDKASLYLTAIEDAEYKEDKIEFW Sbjct: 201 NNGIVLPDKASLYLTAIEDAEYKEDKIEFW 230 >ref|XP_007012896.1| Arginine methyltransferase 11 [Theobroma cacao] gi|508783259|gb|EOY30515.1| Arginine methyltransferase 11 [Theobroma cacao] Length = 398 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +N G+VLPDKASLYLTAIEDAEYK+DKIEFW Sbjct: 213 VNDGIVLPDKASLYLTAIEDAEYKDDKIEFW 243 >ref|XP_002883976.1| hypothetical protein ARALYDRAFT_343233 [Arabidopsis lyrata subsp. lyrata] gi|297329816|gb|EFH60235.1| hypothetical protein ARALYDRAFT_343233 [Arabidopsis lyrata subsp. lyrata] Length = 366 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASLYLTAIEDA YKEDK+EFW Sbjct: 181 VDGGIVLPDKASLYLTAIEDAHYKEDKVEFW 211 >ref|XP_006412834.1| hypothetical protein EUTSA_v100269450mg, partial [Eutrema salsugineum] gi|557114004|gb|ESQ54287.1| hypothetical protein EUTSA_v100269450mg, partial [Eutrema salsugineum] Length = 290 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASL+LTAIED+EYKEDKIEFW Sbjct: 214 VDGGIVLPDKASLFLTAIEDSEYKEDKIEFW 244 >ref|XP_002309219.2| hypothetical protein POPTR_0006s15380g, partial [Populus trichocarpa] gi|550336386|gb|EEE92742.2| hypothetical protein POPTR_0006s15380g, partial [Populus trichocarpa] Length = 449 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++ G+VLPDKASLYLTAIEDAEYKEDKIEFW Sbjct: 264 VSDGIVLPDKASLYLTAIEDAEYKEDKIEFW 294 >gb|AAO32061.1| putative arginine methyltransferase [Brassica rapa subsp. pekinensis] Length = 204 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASL+LTAIED+EYKEDKIEFW Sbjct: 47 VDGGIVLPDKASLFLTAIEDSEYKEDKIEFW 77 >gb|EXB38812.1| Protein arginine N-methyltransferase 1.1 [Morus notabilis] Length = 404 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 NGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 N G+VLPDKASLYLTAIEDAEYK+DKIEFW Sbjct: 220 NDGIVLPDKASLYLTAIEDAEYKDDKIEFW 249 >ref|XP_006661156.1| PREDICTED: probable protein arginine N-methyltransferase 1-like [Oryza brachyantha] Length = 393 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 NGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +GG+VLPDKASL+LTAIEDAEYKEDKIEFW Sbjct: 209 DGGVVLPDKASLHLTAIEDAEYKEDKIEFW 238 >ref|XP_006298196.1| hypothetical protein CARUB_v10014243mg [Capsella rubella] gi|482566905|gb|EOA31094.1| hypothetical protein CARUB_v10014243mg [Capsella rubella] Length = 306 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASLY+TAIEDA YKEDK+EFW Sbjct: 121 VDGGIVLPDKASLYVTAIEDAHYKEDKVEFW 151 >ref|XP_006285816.1| hypothetical protein CARUB_v10007292mg [Capsella rubella] gi|482554521|gb|EOA18714.1| hypothetical protein CARUB_v10007292mg [Capsella rubella] Length = 386 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASL+LTAIED+EYKEDKIEFW Sbjct: 201 VDGGVVLPDKASLHLTAIEDSEYKEDKIEFW 231 >dbj|BAD23315.1| putative protein-arginine N-methyltransferase [Oryza sativa Japonica Group] Length = 306 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 NGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +GG+VLPDKASL+LTAIEDAEYKEDKIEFW Sbjct: 122 DGGVVLPDKASLHLTAIEDAEYKEDKIEFW 151 >ref|XP_003529075.1| PREDICTED: probable protein arginine N-methyltransferase 1-like [Glycine max] Length = 379 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASL+LTAIEDA+YKEDKIEFW Sbjct: 194 VDGGVVLPDKASLHLTAIEDADYKEDKIEFW 224 >ref|XP_002869429.1| hypothetical protein ARALYDRAFT_491807 [Arabidopsis lyrata subsp. lyrata] gi|297315265|gb|EFH45688.1| hypothetical protein ARALYDRAFT_491807 [Arabidopsis lyrata subsp. lyrata] Length = 390 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASL+LTAIED+EYKEDKIEFW Sbjct: 205 VDGGVVLPDKASLHLTAIEDSEYKEDKIEFW 235 >gb|ACU24230.1| unknown [Glycine max] Length = 379 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++GG+VLPDKASL+LTAIEDA+YKEDKIEFW Sbjct: 194 VDGGVVLPDKASLHLTAIEDADYKEDKIEFW 224 >ref|XP_002514159.1| protein arginine n-methyltransferase 1, putative [Ricinus communis] gi|223546615|gb|EEF48113.1| protein arginine n-methyltransferase 1, putative [Ricinus communis] Length = 387 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +N G++LPDKASL+LTAIEDAEYKEDKIEFW Sbjct: 202 VNDGILLPDKASLFLTAIEDAEYKEDKIEFW 232 >gb|EAZ44443.1| hypothetical protein OsJ_29056 [Oryza sativa Japonica Group] Length = 343 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 NGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +GG+VLPDKASL+LTAIEDAEYKEDKIEFW Sbjct: 159 DGGVVLPDKASLHLTAIEDAEYKEDKIEFW 188 >ref|NP_001062975.1| Os09g0359800 [Oryza sativa Japonica Group] gi|122228135|sp|Q0J2C6.1|ANM1_ORYSJ RecName: Full=Probable protein arginine N-methyltransferase 1 gi|152013348|sp|A2Z0C0.1|ANM1_ORYSI RecName: Full=Probable protein arginine N-methyltransferase 1 gi|113631208|dbj|BAF24889.1| Os09g0359800 [Oryza sativa Japonica Group] gi|125563401|gb|EAZ08781.1| hypothetical protein OsI_31042 [Oryza sativa Indica Group] gi|215704683|dbj|BAG94311.1| unnamed protein product [Oryza sativa Japonica Group] Length = 387 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 NGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 +GG+VLPDKASL+LTAIEDAEYKEDKIEFW Sbjct: 203 DGGVVLPDKASLHLTAIEDAEYKEDKIEFW 232 >ref|XP_006451413.1| hypothetical protein CICLE_v10008497mg [Citrus clementina] gi|568842972|ref|XP_006475399.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Citrus sinensis] gi|557554639|gb|ESR64653.1| hypothetical protein CICLE_v10008497mg [Citrus clementina] Length = 405 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 95 INGGLVLPDKASLYLTAIEDAEYKEDKIEFW 3 ++ G+VLPDKASLYLTAIEDAEYK+DKIEFW Sbjct: 220 VDDGIVLPDKASLYLTAIEDAEYKDDKIEFW 250