BLASTX nr result
ID: Akebia27_contig00035751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035751 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME50381.1| hypothetical protein DOTSEDRAFT_95802, partial [D... 65 8e-09 ref|XP_003856299.1| hypothetical protein MYCGRDRAFT_102441 [Zymo... 62 8e-08 >gb|EME50381.1| hypothetical protein DOTSEDRAFT_95802, partial [Dothistroma septosporum NZE10] Length = 352 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +1 Query: 1 QSMPPMPAFHLPSQLPQHCGTDMGMGHFGDFGWSQSSFAASQYAT 135 Q +P MPA LPS LPQHCG+D MG F DFGWSQS+F A QYAT Sbjct: 308 QYVPAMPALTLPSSLPQHCGSDYSMGGFTDFGWSQSNF-APQYAT 351 >ref|XP_003856299.1| hypothetical protein MYCGRDRAFT_102441 [Zymoseptoria tritici IPO323] gi|339476184|gb|EGP91275.1| hypothetical protein MYCGRDRAFT_102441 [Zymoseptoria tritici IPO323] Length = 356 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +1 Query: 1 QSMPPMPAFHLPSQLPQHCGTDMGMGHFGDFGWSQSSFAASQYAT 135 QS+ PMPA +P Q+P HCG DM MG + DFGWSQSS+ QYAT Sbjct: 311 QSIAPMPALIMPHQMPHHCGVDMVMGGYSDFGWSQSSW-TPQYAT 354