BLASTX nr result
ID: Akebia27_contig00035744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035744 (612 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64449.1| hypothetical protein VITISV_008912 [Vitis vinifera] 40 2e-06 >emb|CAN64449.1| hypothetical protein VITISV_008912 [Vitis vinifera] Length = 496 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +1 Query: 121 FKVGLGDAIIF*VDLLWDDSHLIF*FPALYLLSNLKDAFVSQYLKIEDPITSWEFGFRCN 300 F VG G + F D+ W + L FP+LY +++ K+A+V ++ W F Sbjct: 214 FSVGNGRRVKFWKDIWWGNFALCNYFPSLYAIASSKEAWVEEFWDTSGEEGVWSPRFSRP 273 Query: 301 FNDW 312 FNDW Sbjct: 274 FNDW 277 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 393 WRWTTNNRLTMRSFYLELPWKEFSPYLDKMIWKSSAPSKVAFSFKMRYWTRSL 551 W+ T+N +++S Y +L + P+ +IW S PSKV+F W + L Sbjct: 304 WKVTSNGIFSVKSLYNDLSSRRAGPFPHGLIWSPSVPSKVSFFAWKASWGKVL 356