BLASTX nr result
ID: Akebia27_contig00035708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035708 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372275.1| hypothetical protein POPTR_0018s14880g [Popu... 62 8e-08 >ref|XP_006372275.1| hypothetical protein POPTR_0018s14880g [Populus trichocarpa] gi|550318806|gb|ERP50072.1| hypothetical protein POPTR_0018s14880g [Populus trichocarpa] Length = 289 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +2 Query: 254 VFGDISNAVHGSNIQWRGRSFAASVPSNSSKPQKGQKRISKDE 382 VF +++NA+HG+N+QWR RS+AASVPS+ + K QKR+SKD+ Sbjct: 18 VFDEVANAIHGANMQWRARSYAASVPSHMPQSHKAQKRVSKDD 60