BLASTX nr result
ID: Akebia27_contig00035591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035591 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME87970.1| hypothetical protein MYCFIDRAFT_85908 [Pseudocerc... 85 9e-15 gb|EME49500.1| hypothetical protein DOTSEDRAFT_68310 [Dothistrom... 85 1e-14 ref|XP_003856672.1| hypothetical protein MYCGRDRAFT_107643 [Zymo... 84 3e-14 gb|EMF17616.1| GATA-domain-containing protein, partial [Sphaerul... 81 1e-13 gb|EKG20543.1| Zinc finger GATA-type protein [Macrophomina phase... 77 2e-12 ref|XP_754237.1| GATA-type sexual development transcription fact... 74 2e-11 gb|EPE29348.1| Glucocorticoid receptor-like (DNA-binding) [Glare... 74 2e-11 ref|XP_001263076.1| sexual development transcription factor NsdD... 74 2e-11 gb|EXJ64981.1| hypothetical protein A1O7_01320 [Cladophialophora... 74 3e-11 gb|ETI28934.1| hypothetical protein G647_01386 [Cladophialophora... 74 3e-11 gb|EXJ79244.1| hypothetical protein A1O3_08745 [Capronia epimyce... 73 4e-11 gb|ETN38344.1| hypothetical protein HMPREF1541_06379 [Cyphelloph... 73 4e-11 dbj|GAD94635.1| GATA-type sexual development transcription facto... 73 5e-11 gb|EON69122.1| hypothetical protein W97_08308 [Coniosporium apol... 73 5e-11 gb|EHY52028.1| hypothetical protein HMPREF1120_00248 [Exophiala ... 73 5e-11 dbj|GAA84576.1| sexual development transcription factor NsdD [As... 73 5e-11 gb|EHA23254.1| hypothetical protein ASPNIDRAFT_37268 [Aspergillu... 73 5e-11 emb|CAK37830.2| unnamed protein product [Aspergillus niger] 73 5e-11 gb|EYE91587.1| hypothetical protein EURHEDRAFT_464468 [Aspergill... 72 6e-11 gb|EPS27088.1| hypothetical protein PDE_02029 [Penicillium oxali... 72 6e-11 >gb|EME87970.1| hypothetical protein MYCFIDRAFT_85908 [Pseudocercospora fijiensis CIRAD86] Length = 503 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPKE 141 PEWRRGPDGARTLCNACGLHYAKLTRKN +G +KT G+SN+RPKE Sbjct: 454 PEWRRGPDGARTLCNACGLHYAKLTRKN-NGTNKTTNVGSSNLRPKE 499 >gb|EME49500.1| hypothetical protein DOTSEDRAFT_68310 [Dothistroma septosporum NZE10] Length = 515 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPKE 141 PEWRRGPDGARTLCNACGLHYAKLTRKN +GA+K G+SN+RPKE Sbjct: 467 PEWRRGPDGARTLCNACGLHYAKLTRKN-NGANKNTSVGSSNLRPKE 512 >ref|XP_003856672.1| hypothetical protein MYCGRDRAFT_107643 [Zymoseptoria tritici IPO323] gi|339476557|gb|EGP91648.1| hypothetical protein MYCGRDRAFT_107643 [Zymoseptoria tritici IPO323] Length = 522 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPKE 141 PEWRRGPDGARTLCNACGLHYAKLTRK+QS A+K+ G+SN+RPKE Sbjct: 474 PEWRRGPDGARTLCNACGLHYAKLTRKSQS-ANKSSAVGSSNLRPKE 519 >gb|EMF17616.1| GATA-domain-containing protein, partial [Sphaerulina musiva SO2202] Length = 357 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRKN +G +K G+SN+RPK Sbjct: 313 PEWRRGPDGARTLCNACGLHYAKLTRKN-NGTNKNANTGSSNLRPK 357 >gb|EKG20543.1| Zinc finger GATA-type protein [Macrophomina phaseolina MS6] Length = 479 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K P G+SN+RPK Sbjct: 428 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKAP-IGSSNLRPK 470 >ref|XP_754237.1| GATA-type sexual development transcription factor NsdD [Aspergillus fumigatus Af293] gi|66851874|gb|EAL92199.1| GATA-type sexual development transcription factor NsdD [Aspergillus fumigatus Af293] gi|159127255|gb|EDP52370.1| sexual development transcription factor NsdD [Aspergillus fumigatus A1163] Length = 493 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GASK G SN++PK Sbjct: 440 PEWRRGPDGARTLCNACGLHYAKLTRK--MGASKAASLG-SNLKPK 482 >gb|EPE29348.1| Glucocorticoid receptor-like (DNA-binding) [Glarea lozoyensis ATCC 20868] Length = 482 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRKN S+ A S+IRPK Sbjct: 429 PEWRRGPDGARTLCNACGLHYAKLTRKNTMKQSQ--MANGSSIRPK 472 >ref|XP_001263076.1| sexual development transcription factor NsdD [Neosartorya fischeri NRRL 181] gi|119411236|gb|EAW21179.1| sexual development transcription factor NsdD [Neosartorya fischeri NRRL 181] Length = 493 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GASK G SN++PK Sbjct: 440 PEWRRGPDGARTLCNACGLHYAKLTRK--MGASKAASLG-SNLKPK 482 >gb|EXJ64981.1| hypothetical protein A1O7_01320 [Cladophialophora yegresii CBS 114405] Length = 480 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK G +K SN+RPK Sbjct: 430 PEWRRGPDGARTLCNACGLHYAKLTRK--MGVNKAAALTGSNLRPK 473 >gb|ETI28934.1| hypothetical protein G647_01386 [Cladophialophora carrionii CBS 160.54] Length = 472 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK G +K SN+RPK Sbjct: 422 PEWRRGPDGARTLCNACGLHYAKLTRK--MGVNKAAALTGSNLRPK 465 >gb|EXJ79244.1| hypothetical protein A1O3_08745 [Capronia epimyces CBS 606.96] Length = 477 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK G +K SN+RPK Sbjct: 427 PEWRRGPDGARTLCNACGLHYAKLTRK--LGHNKASAMSGSNLRPK 470 >gb|ETN38344.1| hypothetical protein HMPREF1541_06379 [Cyphellophora europaea CBS 101466] Length = 410 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK G +K SN+RPK Sbjct: 361 PEWRRGPDGARTLCNACGLHYAKLTRK--IGVNKAAAMTGSNLRPK 404 >dbj|GAD94635.1| GATA-type sexual development transcription factor NsdD [Byssochlamys spectabilis No. 5] Length = 476 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K G SN++PK Sbjct: 423 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKASSLG-SNLKPK 465 >gb|EON69122.1| hypothetical protein W97_08308 [Coniosporium apollinis CBS 100218] Length = 238 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK +G K+ G SN+RPK Sbjct: 187 PEWRRGPDGARTLCNACGLHYAKLTRK-MNGERKS--LGGSNLRPK 229 >gb|EHY52028.1| hypothetical protein HMPREF1120_00248 [Exophiala dermatitidis NIH/UT8656] Length = 487 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK G +K SN+RPK Sbjct: 437 PEWRRGPDGARTLCNACGLHYAKLTRK--MGHNKAAAMTGSNLRPK 480 >dbj|GAA84576.1| sexual development transcription factor NsdD [Aspergillus kawachii IFO 4308] Length = 453 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K G SN++PK Sbjct: 400 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKASSLG-SNLKPK 442 >gb|EHA23254.1| hypothetical protein ASPNIDRAFT_37268 [Aspergillus niger ATCC 1015] Length = 503 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K G SN++PK Sbjct: 450 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKASSLG-SNLKPK 492 >emb|CAK37830.2| unnamed protein product [Aspergillus niger] Length = 503 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K G SN++PK Sbjct: 450 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKASSLG-SNLKPK 492 >gb|EYE91587.1| hypothetical protein EURHEDRAFT_464468 [Aspergillus ruber CBS 135680] Length = 434 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K G SN++PK Sbjct: 383 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKASALG-SNLKPK 425 >gb|EPS27088.1| hypothetical protein PDE_02029 [Penicillium oxalicum 114-2] Length = 494 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 PEWRRGPDGARTLCNACGLHYAKLTRKNQSGASKTPQAGNSNIRPK 138 PEWRRGPDGARTLCNACGLHYAKLTRK GA+K G SN++PK Sbjct: 441 PEWRRGPDGARTLCNACGLHYAKLTRK--MGANKAATMG-SNLKPK 483