BLASTX nr result
ID: Akebia27_contig00035558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035558 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA81010.1| hypothetical protein SETTUDRAFT_100946 [Setosphae... 90 3e-16 ref|XP_003833577.1| similar to C2H2 transcription factor (Seb1) ... 90 3e-16 gb|EUN27225.1| hypothetical protein COCVIDRAFT_98987 [Bipolaris ... 87 2e-15 gb|EUC40797.1| hypothetical protein COCMIDRAFT_9371 [Bipolaris o... 87 2e-15 gb|EUC38631.1| hypothetical protein COCCADRAFT_21959 [Bipolaris ... 87 2e-15 gb|EMD91134.1| hypothetical protein COCHEDRAFT_21395 [Bipolaris ... 87 2e-15 gb|EMD62151.1| hypothetical protein COCSADRAFT_173537 [Bipolaris... 85 9e-15 ref|XP_001933138.1| cutinase G-box binding protein [Pyrenophora ... 82 1e-13 dbj|BAK05473.1| predicted protein [Hordeum vulgare subsp. vulgare] 81 1e-13 ref|XP_003296711.1| hypothetical protein PTT_06877 [Pyrenophora ... 80 4e-13 gb|EON66783.1| hypothetical protein W97_06031 [Coniosporium apol... 77 3e-12 ref|XP_007581987.1| putative c2h2 transcription factor protein [... 77 3e-12 gb|AFQ60939.1| transcription factor Vf19 [Alternaria brassicicola] 76 4e-12 gb|EMR86077.1| putative cutinase g-box binding protein [Botryoti... 74 2e-11 ref|XP_001561436.1| hypothetical protein BC1G_00521 [Botryotinia... 74 2e-11 gb|EME39634.1| hypothetical protein DOTSEDRAFT_75324 [Dothistrom... 71 1e-10 emb|CCD45456.1| similar to transcription factor Zn, C2H2 [Botryo... 71 2e-10 ref|XP_001594602.1| hypothetical protein SS1G_04409 [Sclerotinia... 70 3e-10 gb|ESZ97955.1| hypothetical protein SBOR_1678 [Sclerotinia borea... 69 7e-10 ref|XP_007296189.1| cutinase G-box binding protein [Marssonina b... 66 4e-09 >gb|EOA81010.1| hypothetical protein SETTUDRAFT_100946 [Setosphaeria turcica Et28A] Length = 538 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/71 (64%), Positives = 55/71 (77%) Frame = +2 Query: 8 TSDFLAPNGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTT 187 TS+F NGLPTFEPLFELD E++ +GLV FP TDN QFLGNKRQRT+L ED F + Sbjct: 251 TSNF---NGLPTFEPLFELDCEDDFNGLVNFP-TDNTQFLGNKRQRTDLGAFSPEDDFLS 306 Query: 188 EECFSDFEDEL 220 +E F+DFE+EL Sbjct: 307 DESFTDFEEEL 317 >ref|XP_003833577.1| similar to C2H2 transcription factor (Seb1) [Leptosphaeria maculans JN3] gi|312210125|emb|CBX90212.1| similar to C2H2 transcription factor (Seb1) [Leptosphaeria maculans JN3] Length = 540 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/72 (56%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = +2 Query: 8 TSDFLA-PNGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFT 184 T+DF P GLPTFEPLFELD E++ +GLV F DN FLGNKRQRT+L+ P E+ F Sbjct: 251 TADFTGLPTGLPTFEPLFELDCEDDFAGLVNFSTADNTHFLGNKRQRTDLVAFPSEEDFV 310 Query: 185 TEECFSDFEDEL 220 ++ F+DFE++L Sbjct: 311 SDASFTDFEEDL 322 >gb|EUN27225.1| hypothetical protein COCVIDRAFT_98987 [Bipolaris victoriae FI3] Length = 546 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDF 208 NGLPTFEPLFELD E++ +GLV F +TDN QFLGNKRQRT+L ED F ++E F+DF Sbjct: 266 NGLPTFEPLFELDCEDDFNGLVNF-STDNTQFLGNKRQRTDLGAFSPEDDFLSDESFTDF 324 Query: 209 EDEL 220 E+EL Sbjct: 325 EEEL 328 >gb|EUC40797.1| hypothetical protein COCMIDRAFT_9371 [Bipolaris oryzae ATCC 44560] Length = 546 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDF 208 NGLPTFEPLFELD E++ +GLV F +TDN QFLGNKRQRT+L ED F ++E F+DF Sbjct: 266 NGLPTFEPLFELDCEDDFNGLVNF-STDNTQFLGNKRQRTDLGAFSPEDDFLSDESFTDF 324 Query: 209 EDEL 220 E+EL Sbjct: 325 EEEL 328 >gb|EUC38631.1| hypothetical protein COCCADRAFT_21959 [Bipolaris zeicola 26-R-13] Length = 546 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDF 208 NGLPTFEPLFELD E++ +GLV F +TDN QFLGNKRQRT+L ED F ++E F+DF Sbjct: 266 NGLPTFEPLFELDCEDDFNGLVNF-STDNTQFLGNKRQRTDLGAFSPEDDFLSDESFTDF 324 Query: 209 EDEL 220 E+EL Sbjct: 325 EEEL 328 >gb|EMD91134.1| hypothetical protein COCHEDRAFT_21395 [Bipolaris maydis C5] gi|477588707|gb|ENI05785.1| hypothetical protein COCC4DRAFT_135862 [Bipolaris maydis ATCC 48331] Length = 546 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDF 208 NGLPTFEPLFELD E++ +GLV F +TDN QFLGNKRQRT+L ED F ++E F+DF Sbjct: 266 NGLPTFEPLFELDCEDDFNGLVNF-STDNTQFLGNKRQRTDLGAFSPEDDFLSDESFTDF 324 Query: 209 EDEL 220 E+EL Sbjct: 325 EEEL 328 >gb|EMD62151.1| hypothetical protein COCSADRAFT_173537 [Bipolaris sorokiniana ND90Pr] Length = 546 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/64 (64%), Positives = 50/64 (78%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDF 208 NGLPTFEPLFELD E++ +GLV F + DN QFLGNKRQRT+L ED F ++E F+DF Sbjct: 266 NGLPTFEPLFELDCEDDFNGLVNF-SNDNTQFLGNKRQRTDLGAFSPEDDFLSDESFTDF 324 Query: 209 EDEL 220 E+EL Sbjct: 325 EEEL 328 >ref|XP_001933138.1| cutinase G-box binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978702|gb|EDU45328.1| cutinase G-box binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 551 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = +2 Query: 32 GLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDFE 211 GLPTFEPLFELD E++ +GLV FPA + AQ+LGNKRQRT+L E+ F ++E F+DFE Sbjct: 268 GLPTFEPLFELDCEDDFTGLVNFPA-ETAQYLGNKRQRTDLGAFSPEEDFLSDESFTDFE 326 Query: 212 DEL 220 +EL Sbjct: 327 EEL 329 >dbj|BAK05473.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 546 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/63 (61%), Positives = 49/63 (77%) Frame = +2 Query: 32 GLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDFE 211 GLPTFEPLFELD E++ +GLV F +TDN FLGNKRQRT+L E+ F ++E F+DFE Sbjct: 267 GLPTFEPLFELDCEDDFTGLVNF-STDNTHFLGNKRQRTDLGAFSPEEDFLSDESFTDFE 325 Query: 212 DEL 220 +EL Sbjct: 326 EEL 328 >ref|XP_003296711.1| hypothetical protein PTT_06877 [Pyrenophora teres f. teres 0-1] gi|311331052|gb|EFQ95218.1| hypothetical protein PTT_06877 [Pyrenophora teres f. teres 0-1] Length = 550 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/63 (60%), Positives = 50/63 (79%) Frame = +2 Query: 32 GLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDFE 211 GLPTFEPLFELD E++ +GLV FPA + AQ+LG+KRQRT+L E+ F ++E F+DFE Sbjct: 268 GLPTFEPLFELDCEDDFTGLVNFPA-ETAQYLGSKRQRTDLGAFSPEEDFLSDESFTDFE 326 Query: 212 DEL 220 +EL Sbjct: 327 EEL 329 >gb|EON66783.1| hypothetical protein W97_06031 [Coniosporium apollinis CBS 100218] Length = 587 Score = 77.0 bits (188), Expect = 3e-12 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +2 Query: 2 PPTSDFLAPNGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLP-LPEEDT 178 P +FL+ NGLPTFEPLFELD+E++ SG VQFPATDN KR RT+ L E+++ Sbjct: 266 PVPPEFLSLNGLPTFEPLFELDSEDDFSGFVQFPATDNTHASNYKRLRTDSLSNSVEDES 325 Query: 179 FTTEECFSDFEDELS 223 F + FS+F+++L+ Sbjct: 326 FFGDSSFSEFDEDLA 340 >ref|XP_007581987.1| putative c2h2 transcription factor protein [Neofusicoccum parvum UCRNP2] gi|485926245|gb|EOD50561.1| putative c2h2 transcription factor protein [Neofusicoccum parvum UCRNP2] Length = 577 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/75 (50%), Positives = 52/75 (69%), Gaps = 1/75 (1%) Frame = +2 Query: 5 PTSDFLAPNGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLP-EEDTF 181 PT+DF + TFEPLFELD+E++ + VQFP+T+NA + GNKRQRT L E+D+ Sbjct: 286 PTADFTSNPQQLTFEPLFELDSEDDFNAAVQFPSTENASYNGNKRQRTNFSSLSLEDDSL 345 Query: 182 TTEECFSDFEDELSN 226 E+ FSDF DE ++ Sbjct: 346 VDEDNFSDFGDEFAH 360 >gb|AFQ60939.1| transcription factor Vf19 [Alternaria brassicicola] Length = 547 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = +2 Query: 32 GLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLPLPEEDTFTTEECFSDFE 211 GLPTFEPLFELD E++ +GLV F D FLGNKRQRT+L E+ F ++E F+DFE Sbjct: 268 GLPTFEPLFELDCEDDFTGLVNFSTADT-HFLGNKRQRTDLGAFSPEEDFLSDESFTDFE 326 Query: 212 DEL 220 +EL Sbjct: 327 EEL 329 >gb|EMR86077.1| putative cutinase g-box binding protein [Botryotinia fuckeliana BcDW1] Length = 640 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/71 (54%), Positives = 52/71 (73%), Gaps = 2/71 (2%) Frame = +2 Query: 8 TSDFLAPNGLPTFEPLFELDTEEE-LSGLVQFPATDNAQFLGNKRQRT-ELLPLPEEDTF 181 T+ + +GLPTF+ L ELD+E+E ++GLV FP+TDN QF G+KRQRT L PE +TF Sbjct: 330 TTTTTSNHGLPTFDHLSELDSEDEFVNGLVNFPSTDNVQFFGSKRQRTVSDLVSPESETF 389 Query: 182 TTEECFSDFED 214 +E+ F DFED Sbjct: 390 ISEDDFEDFED 400 >ref|XP_001561436.1| hypothetical protein BC1G_00521 [Botryotinia fuckeliana B05.10] Length = 601 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/71 (54%), Positives = 52/71 (73%), Gaps = 2/71 (2%) Frame = +2 Query: 8 TSDFLAPNGLPTFEPLFELDTEEE-LSGLVQFPATDNAQFLGNKRQRT-ELLPLPEEDTF 181 T+ + +GLPTF+ L ELD+E+E ++GLV FP+TDN QF G+KRQRT L PE +TF Sbjct: 291 TTTTTSNHGLPTFDHLSELDSEDEFVNGLVNFPSTDNVQFFGSKRQRTVSDLVSPESETF 350 Query: 182 TTEECFSDFED 214 +E+ F DFED Sbjct: 351 ISEDDFEDFED 361 >gb|EME39634.1| hypothetical protein DOTSEDRAFT_75324 [Dothistroma septosporum NZE10] Length = 597 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/74 (48%), Positives = 53/74 (71%), Gaps = 1/74 (1%) Frame = +2 Query: 11 SDFLAPNGLPTFEPLFELDTEEELSGLVQFPATDNAQFLGNKRQRTELLP-LPEEDTFTT 187 SD + G PTFEP+F+LDTE+E SGLV + + + G+KRQR +L+P L ++D F + Sbjct: 280 SDLVQYGGYPTFEPIFDLDTEDEFSGLVAYGGQPDVHYQGSKRQRLDLVPALIDDDGFFS 339 Query: 188 EECFSDFEDELSNQ 229 EE FSD EDE++++ Sbjct: 340 EESFSD-EDEMAHR 352 >emb|CCD45456.1| similar to transcription factor Zn, C2H2 [Botryotinia fuckeliana T4] Length = 601 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/71 (53%), Positives = 51/71 (71%), Gaps = 2/71 (2%) Frame = +2 Query: 8 TSDFLAPNGLPTFEPLFELDTEEE-LSGLVQFPATDNAQFLGNKRQRT-ELLPLPEEDTF 181 T+ + +GLPTF+ L ELD+E+E ++GLV FP+TDN QF G+KRQRT L E +TF Sbjct: 291 TTTTTSNHGLPTFDHLSELDSEDEFVNGLVNFPSTDNVQFFGSKRQRTVSDLVSSESETF 350 Query: 182 TTEECFSDFED 214 +E+ F DFED Sbjct: 351 ISEDDFEDFED 361 >ref|XP_001594602.1| hypothetical protein SS1G_04409 [Sclerotinia sclerotiorum 1980] gi|154702195|gb|EDO01934.1| hypothetical protein SS1G_04409 [Sclerotinia sclerotiorum 1980 UF-70] Length = 600 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/64 (54%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEE-LSGLVQFPATDNAQFLGNKRQRT-ELLPLPEEDTFTTEECFS 202 +GLPTF+ + +LD+E+E ++GLV FP+TDN QF GNKRQRT L P +TF +E+ F Sbjct: 297 HGLPTFDHISDLDSEDEFVNGLVNFPSTDNVQFFGNKRQRTVSDLVSPTSETFISEDDFE 356 Query: 203 DFED 214 DF+D Sbjct: 357 DFDD 360 >gb|ESZ97955.1| hypothetical protein SBOR_1678 [Sclerotinia borealis F-4157] Length = 606 Score = 68.9 bits (167), Expect = 7e-10 Identities = 37/65 (56%), Positives = 49/65 (75%), Gaps = 3/65 (4%) Frame = +2 Query: 29 NGLPTFEPLFELDTEEE-LSGLVQFPATDNAQFL-GNKRQRTEL-LPLPEEDTFTTEECF 199 +GLPTF+ + +LD+E+E ++GLV FP+TDN QF GNKRQRT L PE +TF +E+ F Sbjct: 302 HGLPTFDHISDLDSEDEFVNGLVNFPSTDNVQFFGGNKRQRTASDLVSPEPETFISEDDF 361 Query: 200 SDFED 214 DFED Sbjct: 362 EDFED 366 >ref|XP_007296189.1| cutinase G-box binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860524|gb|EKD13582.1| cutinase G-box binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 692 Score = 66.2 bits (160), Expect = 4e-09 Identities = 42/81 (51%), Positives = 54/81 (66%), Gaps = 8/81 (9%) Frame = +2 Query: 8 TSDFLAP---NGLPTFEPLFELDTEEE-LSGLVQFPATDNAQFLGNKRQRT----ELLPL 163 T DF P +GLPTF+ L ELD+EE+ ++GLV FP+T NAQF G KRQRT +L+ L Sbjct: 367 TFDFSTPITHHGLPTFDQLSELDSEEDFVNGLVNFPSTSNAQFFGTKRQRTSSGSDLVTL 426 Query: 164 PEEDTFTTEECFSDFEDELSN 226 E FT+E+ +FE EL N Sbjct: 427 DHEQ-FTSEDDLEEFE-ELDN 445