BLASTX nr result
ID: Akebia27_contig00035516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035516 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS68701.1| Inositol hexakisphosphate and diphosphoinositol-p... 53 2e-06 gb|EMS52533.1| ATP-citrate synthase [Triticum urartu] 54 2e-06 gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Tritic... 53 2e-06 ref|XP_003581610.1| PREDICTED: uncharacterized protein LOC100840... 51 5e-06 gb|EXC31207.1| DNA ligase 4 [Morus notabilis] 52 8e-06 gb|EXB56439.1| putative CRM domain-containing protein [Morus not... 52 8e-06 >gb|EMS68701.1| Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 [Triticum urartu] Length = 636 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 316 IIKVMY*KVVISVRVNGEETNEFPITISLHK*LALSPFMFAIVIDELPTNSQ 161 IIK MY VV SVR N + ++FPI I LH+ ALSP++FA+V+DE+ + Q Sbjct: 8 IIKDMYDNVVTSVRTNVGDNDDFPIKIELHQGSALSPYIFALVMDEVTRDIQ 59 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 93 EIKGFKISRTKNKHFEYKF 37 E KGF+ISRTK ++ F Sbjct: 94 ESKGFRISRTKTEYMRCSF 112 >gb|EMS52533.1| ATP-citrate synthase [Triticum urartu] Length = 589 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -3 Query: 316 IIKVMY*KVVISVRVNGEETNEFPITISLHK*LALSPFMFAIVIDELPTNSQ 161 +IK MY VV SVR + +T++FPI I LH+ ALSP++FA+V+DE+ + Q Sbjct: 444 LIKDMYDNVVTSVRTSNVDTDDFPIKIGLHQGSALSPYLFALVMDEVTRDIQ 495 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 93 EIKGFKISRTKNKHFEYKFS 34 E KGF++SRTK ++ FS Sbjct: 530 ESKGFRLSRTKTEYMMCGFS 549 >gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Triticum urartu] Length = 882 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -3 Query: 316 IIKVMY*KVVISVRVNGEETNEFPITISLHK*LALSPFMFAIVIDELPTNSQ 161 +IK MY VV SVR + +T++FPI I LH+ ALSP++FA+V+DE+ + Q Sbjct: 201 LIKDMYDNVVTSVRTSDVDTDDFPIKIGLHQGSALSPYLFALVMDEVTRDIQ 252 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 93 EIKGFKISRTKNKHFEYKFS 34 E KGF++SRTK ++ FS Sbjct: 287 ESKGFRLSRTKTEYMMCGFS 306 >ref|XP_003581610.1| PREDICTED: uncharacterized protein LOC100840703 [Brachypodium distachyon] Length = 567 Score = 50.8 bits (120), Expect(2) = 5e-06 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = -3 Query: 316 IIKVMY*KVVISVRVNGEETNEFPITISLHK*LALSPFMFAIVIDELPTNSQ 161 +IK MY VV SVR + +T++FPI I LH+ ALSP++F +V+DE+ + Q Sbjct: 251 LIKDMYDNVVTSVRTSDGDTDDFPIKIGLHQGSALSPYLFDLVMDEVTRDIQ 302 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 93 EIKGFKISRTKNKHFEYKFS 34 E KGF++SRTK ++ + FS Sbjct: 337 ESKGFRLSRTKTEYMKCGFS 356 >gb|EXC31207.1| DNA ligase 4 [Morus notabilis] Length = 627 Score = 51.6 bits (122), Expect(2) = 8e-06 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = -3 Query: 334 QVYIFDIIKVMY*KVVISVRVNGEETNEFPITISLHK*LALSPFMFAIVIDE 179 +V +IK MY VV SVR G T EFPI I LH+ ALSP+ F IV+DE Sbjct: 573 RVRYIKVIKDMYDGVVTSVRTVGGYTTEFPIRIGLHQRSALSPYFFTIVVDE 624 Score = 23.5 bits (49), Expect(2) = 8e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 371 ELIWWVLGKRDFSSIYI 321 E++WWVL KR YI Sbjct: 561 EVLWWVLEKRGVRVRYI 577 >gb|EXB56439.1| putative CRM domain-containing protein [Morus notabilis] Length = 506 Score = 51.6 bits (122), Expect(2) = 8e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -3 Query: 316 IIKVMY*KVVISVRVNGEETNEFPITISLHK*LALSPFMFAIVIDELPTNSQ 161 +IK MY +VV SVR G T EFPI I L++ ALSP++F IV+DEL Q Sbjct: 188 VIKDMYDRVVTSVRTAGGYTAEFPIRIGLNQGSALSPYLFTIVMDELTREIQ 239 Score = 23.5 bits (49), Expect(2) = 8e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 371 ELIWWVLGKRDFSSIYI 321 E++WWVL KR YI Sbjct: 170 EVLWWVLEKRGVHVRYI 186