BLASTX nr result
ID: Akebia27_contig00035216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035216 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003300248.1| hypothetical protein PTT_11431 [Pyrenophora ... 56 5e-06 ref|XP_001942207.1| hypothetical protein PTRG_11876 [Pyrenophora... 56 5e-06 >ref|XP_003300248.1| hypothetical protein PTT_11431 [Pyrenophora teres f. teres 0-1] gi|311325719|gb|EFQ91654.1| hypothetical protein PTT_11431 [Pyrenophora teres f. teres 0-1] Length = 69 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/46 (50%), Positives = 29/46 (63%) Frame = -1 Query: 294 FKTGSSCPPQCNGLTRCSKEGNNVIKCVNGHWKKITHCNHCKSGSC 157 ++TGSSC C G RC + N VI+CVN W + HC HCK G+C Sbjct: 24 YRTGSSCDQTCAGAQRCGDD-NYVIQCVNNVWTRKQHCEHCKFGAC 68 >ref|XP_001942207.1| hypothetical protein PTRG_11876 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979406|gb|EDU46032.1| hypothetical protein PTRG_11876 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 69 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/46 (50%), Positives = 29/46 (63%) Frame = -1 Query: 294 FKTGSSCPPQCNGLTRCSKEGNNVIKCVNGHWKKITHCNHCKSGSC 157 ++TGSSC C G RC + N VI+CVN W + HC HCK G+C Sbjct: 24 YRTGSSCDQTCAGAQRCGDD-NYVIQCVNNVWTRKQHCEHCKFGAC 68