BLASTX nr result
ID: Akebia27_contig00035117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035117 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB69304.1| hypothetical protein L484_002862 [Morus notabilis] 58 1e-06 >gb|EXB69304.1| hypothetical protein L484_002862 [Morus notabilis] Length = 575 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +2 Query: 305 GGVRMYIAINLKRYRAVKKVGNITMNIRIIGYYQLMQI 418 GGVRM+IA+ +KRYRAVK+VG I M++ II YYQ+MQ+ Sbjct: 297 GGVRMFIAVTIKRYRAVKEVGKIKMSVGIIAYYQVMQV 334