BLASTX nr result
ID: Akebia27_contig00035048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035048 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS82498.1| hypothetical protein PFICI_04374 [Pestalotiopsis ... 64 2e-08 >gb|ETS82498.1| hypothetical protein PFICI_04374 [Pestalotiopsis fici W106-1] Length = 92 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 108 QLEKDAARAMTATRSWQPALERRQSYQKEDQKHELQ 1 QLEKDAARAM++T SW+PA ER+QSY KEDQKHELQ Sbjct: 30 QLEKDAARAMSSTSSWKPAYERKQSYHKEDQKHELQ 65