BLASTX nr result
ID: Akebia27_contig00034834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00034834 (600 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007589044.1| putative gpr1 fun34 -class plasma membrane p... 65 1e-08 gb|EFQ32129.1| GPR1/FUN34/YaaH-class plasma membrane protein [Co... 64 2e-08 gb|EXJ72442.1| hypothetical protein A1O5_04946 [Cladophialophora... 64 3e-08 gb|EKG10059.1| GPR1/FUN34/yaaH [Macrophomina phaseolina MS6] 64 4e-08 gb|EMC93359.1| hypothetical protein BAUCODRAFT_133301 [Baudoinia... 63 5e-08 emb|CCF38192.1| GPR1/FUN34/YaaH-class plasma membrane protein [C... 63 7e-08 ref|XP_007595073.1| GPR1/FUN34/YaaH-class plasma membrane protei... 62 9e-08 emb|CCX10919.1| Similar to Protein alcS; acc. no. Q24JP1 [Pyrone... 62 2e-07 gb|EWZ89067.1| hypothetical protein FOWG_08821 [Fusarium oxyspor... 60 5e-07 ref|XP_381756.1| hypothetical protein FG01580.1 [Fusarium gramin... 60 5e-07 emb|CCT61732.1| related to Y.lipolytica GPR1 protein and Fun34p ... 60 5e-07 gb|EMT64631.1| Protein alcS [Fusarium oxysporum f. sp. cubense r... 60 5e-07 gb|EME79659.1| hypothetical protein MYCFIDRAFT_142753, partial [... 60 5e-07 gb|EKJ68837.1| hypothetical protein FPSE_11003 [Fusarium pseudog... 60 5e-07 ref|XP_006674139.1| plasma membrane ammonium transporter (Ato3) ... 60 5e-07 ref|XP_003049619.1| predicted protein [Nectria haematococca mpVI... 60 5e-07 tpg|DAA06469.1| TPA_inf: GPR1/FUN34/YaaH-class plasma membrane p... 60 5e-07 tpg|DAA06467.1| TPA_inf: GPR1/FUN34/YaaH-class plasma membrane p... 60 5e-07 gb|ESZ92125.1| hypothetical protein SBOR_7504 [Sclerotinia borea... 59 8e-07 gb|EPE33071.1| hypothetical protein GLAREA_06083 [Glarea lozoyen... 59 8e-07 >ref|XP_007589044.1| putative gpr1 fun34 -class plasma membrane protein [Neofusicoccum parvum UCRNP2] gi|485916073|gb|EOD43484.1| putative gpr1 fun34 -class plasma membrane protein [Neofusicoccum parvum UCRNP2] Length = 301 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEKV*AESKI 142 F C GWWIF AI+ A+LDFP QLPVGDLS ++KG SEK A++ + Sbjct: 255 FVTCACGWWIFFAIMLAALDFPFQLPVGDLSTMIKGASEKRRADNNV 301 >gb|EFQ32129.1| GPR1/FUN34/YaaH-class plasma membrane protein [Colletotrichum graminicola M1.001] Length = 314 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 FA C+ GWW+ AIL ASLDFP++LPVGDLS +++G SEK Sbjct: 272 FATCMAGWWLIFAILLASLDFPLELPVGDLSRVIRGKSEK 311 >gb|EXJ72442.1| hypothetical protein A1O5_04946 [Cladophialophora psammophila CBS 110553] Length = 300 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 FAVC+LGW++ TA L A++DFP+ +PVGDLSH+VKG SE+ Sbjct: 249 FAVCLLGWYLLTAQLLAAVDFPLNVPVGDLSHLVKGASER 288 >gb|EKG10059.1| GPR1/FUN34/yaaH [Macrophomina phaseolina MS6] Length = 301 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C GWWIF AI+ A+LDFP QLPVGDLS +KG SEK Sbjct: 254 FVTCACGWWIFFAIMLAALDFPFQLPVGDLSTTIKGASEK 293 >gb|EMC93359.1| hypothetical protein BAUCODRAFT_133301 [Baudoinia compniacensis UAMH 10762] Length = 310 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F V +LGWWIF AI+ A+LDFP Q+PV D+SHI+KG SE+ Sbjct: 258 FVVDLLGWWIFAAIMLAALDFPFQIPVFDISHIIKGASER 297 >emb|CCF38192.1| GPR1/FUN34/YaaH-class plasma membrane protein [Colletotrichum higginsianum] Length = 335 Score = 62.8 bits (151), Expect = 7e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GWW+ AIL ASLDFP++LPVGDLS +++G SEK Sbjct: 293 FVTCMAGWWLIFAILLASLDFPLELPVGDLSRVIRGKSEK 332 >ref|XP_007595073.1| GPR1/FUN34/YaaH-class plasma membrane protein [Colletotrichum fioriniae PJ7] gi|588900681|gb|EXF81253.1| GPR1/FUN34/YaaH-class plasma membrane protein [Colletotrichum fioriniae PJ7] Length = 319 Score = 62.4 bits (150), Expect = 9e-08 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C GWW+ AIL ASLDFP++LPVGDLS +++G SEK Sbjct: 277 FVTCAAGWWLIFAILLASLDFPLELPVGDLSRVIRGKSEK 316 >emb|CCX10919.1| Similar to Protein alcS; acc. no. Q24JP1 [Pyronema omphalodes CBS 100304] Length = 276 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F VC+ W++F ++ AS+DFPI LPVGDLS +VKGGSEK Sbjct: 232 FVVCIFAWYLFLVLVLASVDFPISLPVGDLSTVVKGGSEK 271 >gb|EWZ89067.1| hypothetical protein FOWG_08821 [Fusarium oxysporum f. sp. lycopersici MN25] Length = 289 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 246 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 285 >ref|XP_381756.1| hypothetical protein FG01580.1 [Fusarium graminearum PH-1] gi|224775787|tpg|DAA06465.1| TPA_inf: GPR1/FUN34/YaaH-class plasma membrane protein [Fusarium graminearum] gi|558856828|gb|ESU06911.1| hypothetical protein FGSG_01580 [Fusarium graminearum PH-1] gi|596542167|gb|EYB22645.1| hypothetical protein FG05_01580 [Fusarium graminearum] Length = 290 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 247 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 286 >emb|CCT61732.1| related to Y.lipolytica GPR1 protein and Fun34p [Fusarium fujikuroi IMI 58289] Length = 289 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 246 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 285 >gb|EMT64631.1| Protein alcS [Fusarium oxysporum f. sp. cubense race 4] gi|591478852|gb|EXM09912.1| hypothetical protein FOIG_00217 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 289 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 246 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 285 >gb|EME79659.1| hypothetical protein MYCFIDRAFT_142753, partial [Pseudocercospora fijiensis CIRAD86] Length = 274 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F +LGWWIF AIL ASLDFP QLPV DLS VKG S+K Sbjct: 227 FVTDMLGWWIFFAILLASLDFPFQLPVVDLSRFVKGASDK 266 >gb|EKJ68837.1| hypothetical protein FPSE_11003 [Fusarium pseudograminearum CS3096] Length = 290 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 247 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 286 >ref|XP_006674139.1| plasma membrane ammonium transporter (Ato3) [Cordyceps militaris CM01] gi|346319292|gb|EGX88894.1| plasma membrane ammonium transporter (Ato3) [Cordyceps militaris CM01] Length = 281 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 FA LGW++F A+LFA++DFPIQLPVGDLS +V+G SE+ Sbjct: 238 FACASLGWYLFLALLFAAVDFPIQLPVGDLSSLVRGHSER 277 >ref|XP_003049619.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256730555|gb|EEU43906.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 289 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 246 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGKSEK 285 >tpg|DAA06469.1| TPA_inf: GPR1/FUN34/YaaH-class plasma membrane protein [Fusarium verticillioides] gi|584141105|gb|EWG50436.1| hypothetical protein FVEG_09658 [Fusarium verticillioides 7600] Length = 289 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 246 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 285 >tpg|DAA06467.1| TPA_inf: GPR1/FUN34/YaaH-class plasma membrane protein [Fusarium oxysporum f. sp. lycopersici 4286] gi|342878792|gb|EGU80081.1| hypothetical protein FOXB_09356 [Fusarium oxysporum Fo5176] gi|477520451|gb|ENH72577.1| Protein alcS [Fusarium oxysporum f. sp. cubense race 1] gi|587658032|gb|EWY80423.1| hypothetical protein FOYG_16409 [Fusarium oxysporum FOSC 3-a] gi|587702877|gb|EWZ49482.1| hypothetical protein FOZG_00400 [Fusarium oxysporum Fo47] gi|587756681|gb|EXA54397.1| hypothetical protein FOVG_01862 [Fusarium oxysporum f. sp. pisi HDV247] gi|590044869|gb|EXK46727.1| hypothetical protein FOMG_00393 [Fusarium oxysporum f. sp. melonis 26406] gi|590066118|gb|EXK93642.1| hypothetical protein FOQG_04891 [Fusarium oxysporum f. sp. raphani 54005] gi|591411156|gb|EXL46293.1| hypothetical protein FOCG_12235 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591455611|gb|EXL87842.1| hypothetical protein FOPG_01426 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591499680|gb|EXM29104.1| hypothetical protein FOTG_05334 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 289 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F C+ GW+I A+LFA +DFPIQ+PVGDLS ++KG SEK Sbjct: 246 FVTCMSGWYILIAVLFAIVDFPIQIPVGDLSTVIKGHSEK 285 >gb|ESZ92125.1| hypothetical protein SBOR_7504 [Sclerotinia borealis F-4157] Length = 312 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSEK 121 F + GWWIF AI+ A+LDFP Q+PVGDLS ++KG SE+ Sbjct: 265 FVTSMAGWWIFFAIMLAALDFPFQIPVGDLSTLIKGASER 304 >gb|EPE33071.1| hypothetical protein GLAREA_06083 [Glarea lozoyensis ATCC 20868] Length = 332 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +2 Query: 2 FAVCVLGWWIFTAILFASLDFPIQLPVGDLSHIVKGGSE 118 F + GWWIF AI+ A+LDFP Q+PVGDLS ++KG SE Sbjct: 276 FVTSMAGWWIFAAIMLAALDFPFQIPVGDLSTLIKGASE 314