BLASTX nr result
ID: Akebia27_contig00034815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00034815 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHM22938.1| ethylene response factor 2 [Nicotiana tabacum] 59 9e-07 gb|AGC79344.1| ethylene response factor 10 [Diospyros kaki] 56 6e-06 gb|AGU44838.1| ethylene responsive factor [Capsicum chinense] 55 8e-06 >gb|AHM22938.1| ethylene response factor 2 [Nicotiana tabacum] Length = 247 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/51 (58%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -2 Query: 227 MASESYMRFYQIPYLDGDVEQCIAS--NPIQESVVSGPSMDLWSFDDVLPS 81 MA ES M+FY+IPY+DG Q +A+ NP E+VV G SMDLW+FDDV P+ Sbjct: 194 MAYESLMKFYEIPYVDG---QSVAATVNPAGEAVVGGGSMDLWTFDDVSPT 241 >gb|AGC79344.1| ethylene response factor 10 [Diospyros kaki] Length = 291 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -2 Query: 227 MASESYMRFYQIPYLDGDVEQCIASNPIQESVVSGPSMDLWSFDDVL 87 +A ES M+FYQIPYLDG N QESV++G ++DLWSFDDVL Sbjct: 241 LAYESVMKFYQIPYLDGQSPPA-PPNLAQESVLAGGALDLWSFDDVL 286 >gb|AGU44838.1| ethylene responsive factor [Capsicum chinense] Length = 264 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 227 MASESYMRFYQIPYLDGDVEQCIASNPIQESVVSGPSMDLWSFDDV 90 MA ES M+FY+IPY+DG + +NP E+VV G M+LWSFDDV Sbjct: 210 MAYESLMKFYEIPYVDGQ-SVAVMANPAAEAVVGGGLMELWSFDDV 254