BLASTX nr result
ID: Akebia27_contig00034800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00034800 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853976.1| hypothetical protein MYCGRDRAFT_70190 [Zymos... 100 3e-19 gb|EME84497.1| hypothetical protein MYCFIDRAFT_163304 [Pseudocer... 99 5e-19 gb|EMC94073.1| hypothetical protein BAUCODRAFT_36548 [Baudoinia ... 98 1e-18 gb|EMF13133.1| Annexin [Sphaerulina musiva SO2202] 96 4e-18 gb|EME45852.1| hypothetical protein DOTSEDRAFT_79703 [Dothistrom... 91 2e-16 gb|EPS33423.1| hypothetical protein PDE_08385 [Penicillium oxali... 77 2e-12 ref|XP_755722.1| annexin ANXC3.2 [Aspergillus fumigatus Af293] g... 77 3e-12 ref|XP_001260847.1| annexin ANXC3.2 [Neosartorya fischeri NRRL 1... 76 6e-12 gb|EHA22911.1| hypothetical protein ASPNIDRAFT_52224 [Aspergillu... 75 9e-12 ref|XP_002143275.1| annexin ANXC3.2 [Talaromyces marneffei ATCC ... 75 9e-12 ref|XP_001399657.1| annexin XIV-like protein [Aspergillus niger ... 75 9e-12 gb|ETN39785.1| hypothetical protein HMPREF1541_06011 [Cyphelloph... 75 1e-11 gb|EON65653.1| hypothetical protein W97_04892 [Coniosporium apol... 74 2e-11 gb|EMR81708.1| putative annexin-like protein [Botryotinia fuckel... 74 2e-11 emb|CCD56299.1| similar to calpactin heavy chain [Botryotinia fu... 74 2e-11 ref|XP_001556794.1| hypothetical protein BC1G_04812 [Botryotinia... 74 2e-11 gb|EMD60368.1| hypothetical protein COCSADRAFT_242065 [Bipolaris... 74 3e-11 ref|XP_001821673.1| annexin XIV-like protein [Aspergillus oryzae... 74 3e-11 ref|XP_002379761.1| SH3 domain protein [Aspergillus flavus NRRL3... 74 3e-11 ref|XP_002479586.1| annexin ANXC3.2 [Talaromyces stipitatus ATCC... 74 3e-11 >ref|XP_003853976.1| hypothetical protein MYCGRDRAFT_70190 [Zymoseptoria tritici IPO323] gi|339473859|gb|EGP88952.1| hypothetical protein MYCGRDRAFT_70190 [Zymoseptoria tritici IPO323] Length = 447 Score = 100 bits (248), Expect = 3e-19 Identities = 44/60 (73%), Positives = 51/60 (85%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKDTALVRR+VM+HW +R QQCKAAYKHF+KRDL RI+ ETSGDY+KLM C+ Sbjct: 385 MKGMGTKDTALVRRVVMIHWDRQRLQQCKAAYKHFYKRDLVERIKSETSGDYKKLMAVCV 444 >gb|EME84497.1| hypothetical protein MYCFIDRAFT_163304 [Pseudocercospora fijiensis CIRAD86] Length = 398 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/60 (73%), Positives = 51/60 (85%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKDTALVRR+VM+HW +R QQ KAAYKHF+KRDL RI+ ETSGDY+KLMV C+ Sbjct: 335 MKGLGTKDTALVRRVVMIHWDKQRLQQAKAAYKHFYKRDLAERIKSETSGDYKKLMVVCV 394 >gb|EMC94073.1| hypothetical protein BAUCODRAFT_36548 [Baudoinia compniacensis UAMH 10762] Length = 450 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M+G GT D+AL+RRIVM+HW+ +R QQCKAAYKHF+KRDL RI ET GDYEKLM+ACI Sbjct: 382 MRGMGTNDSALIRRIVMIHWNRDRLQQCKAAYKHFYKRDLAERIRSETRGDYEKLMLACI 441 >gb|EMF13133.1| Annexin [Sphaerulina musiva SO2202] Length = 449 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M G GTKD ALVRR+VM+HW +R QCKAAYKHF+K+DL +RI ETSGDY+KLMVAC+ Sbjct: 389 MAGLGTKDQALVRRVVMIHWDKQRLHQCKAAYKHFYKKDLAARIASETSGDYKKLMVACV 448 >gb|EME45852.1| hypothetical protein DOTSEDRAFT_79703 [Dothistroma septosporum NZE10] Length = 463 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M G GTKD ALVRRIV +HW +R QQ KAAYKHFHKRDL +R++ ETSGDY+KLMV + Sbjct: 403 MAGMGTKDQALVRRIVAIHWDKQRLQQVKAAYKHFHKRDLAARVQSETSGDYKKLMVVLL 462 >gb|EPS33423.1| hypothetical protein PDE_08385 [Penicillium oxalicum 114-2] Length = 439 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/60 (56%), Positives = 46/60 (76%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M G GTKD LV R+V VHW+ + K Q KAAY+H + +DL +R++GETSGDY++LMVA + Sbjct: 379 MSGMGTKDDKLVTRVVRVHWNRQHKDQVKAAYRHRYGKDLIARVQGETSGDYKRLMVALL 438 >ref|XP_755722.1| annexin ANXC3.2 [Aspergillus fumigatus Af293] gi|47059733|gb|AAT09449.1| annexin ANXC3.2 [Aspergillus fumigatus] gi|66853360|gb|EAL93684.1| annexin ANXC3.2 [Aspergillus fumigatus Af293] gi|159129779|gb|EDP54893.1| annexin ANXC3.2 [Aspergillus fumigatus A1163] Length = 446 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V +HW+ + Q K AY H +KRDL +R+ GETSGDY+KLMVA + Sbjct: 386 MKGMGTKDEKLVTRVVRLHWNRQHLDQVKRAYHHRYKRDLIARVRGETSGDYQKLMVALL 445 >ref|XP_001260847.1| annexin ANXC3.2 [Neosartorya fischeri NRRL 181] gi|119409001|gb|EAW18950.1| annexin ANXC3.2 [Neosartorya fischeri NRRL 181] Length = 446 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V VHW+ + Q K AY H +K+DL +R+ GETSGDY+KLMVA + Sbjct: 386 MKGMGTKDEKLVVRVVRVHWNRQHLDQVKRAYHHRYKKDLIARVRGETSGDYQKLMVALL 445 >gb|EHA22911.1| hypothetical protein ASPNIDRAFT_52224 [Aspergillus niger ATCC 1015] Length = 460 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V +HW+P Q K AY+H ++DL R+ GETSGDY++LMVA + Sbjct: 400 MKGMGTKDEKLVTRVVRIHWAPGHLDQVKRAYRHRFQKDLIERVRGETSGDYQRLMVALL 459 >ref|XP_002143275.1| annexin ANXC3.2 [Talaromyces marneffei ATCC 18224] gi|210072673|gb|EEA26760.1| annexin ANXC3.2 [Talaromyces marneffei ATCC 18224] Length = 446 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/60 (56%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M G GTKD LV RIV +HW+ + Q K AY+H + RDLR R++GE SGDYEKLM+A + Sbjct: 385 MAGPGTKDFMLVTRIVRLHWNKQHLDQVKKAYQHHYHRDLRERVKGEVSGDYEKLMLALL 444 >ref|XP_001399657.1| annexin XIV-like protein [Aspergillus niger CBS 513.88] gi|134056573|emb|CAK37627.1| unnamed protein product [Aspergillus niger] Length = 449 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V +HW+P Q K AY+H ++DL R+ GETSGDY++LMVA + Sbjct: 389 MKGMGTKDEKLVTRVVRIHWAPGHLDQVKRAYRHRFQKDLIERVRGETSGDYQRLMVALL 448 >gb|ETN39785.1| hypothetical protein HMPREF1541_06011 [Cyphellophora europaea CBS 101466] Length = 461 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M G GTKD LV R+V +HW K Q K AY+H +KRDL +R++GETSGDY +L+VA + Sbjct: 401 MAGLGTKDKLLVNRVVRIHWDRAHKDQVKRAYQHRYKRDLIARVQGETSGDYRELLVALL 460 >gb|EON65653.1| hypothetical protein W97_04892 [Coniosporium apollinis CBS 100218] Length = 458 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVAC 186 MKG GTKD LV R+V HW+ Q KAA+KH ++++L RI+ ET GDYE+LMVAC Sbjct: 398 MKGMGTKDELLVNRVVRAHWNRGHMQNVKAAHKHVYRKELIDRIKSETRGDYERLMVAC 456 >gb|EMR81708.1| putative annexin-like protein [Botryotinia fuckeliana BcDW1] Length = 469 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V HW P+ Q K AY+H + R L SRI +TSG YEKLMV C+ Sbjct: 397 MKGFGTKDKLLVARVVRCHWDPKHMDQVKGAYQHAYGRSLASRISADTSGYYEKLMVKCV 456 >emb|CCD56299.1| similar to calpactin heavy chain [Botryotinia fuckeliana T4] Length = 483 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V HW P+ Q K AY+H + R L SRI +TSG YEKLMV C+ Sbjct: 411 MKGFGTKDKLLVARVVRCHWDPKHMDQVKGAYQHAYGRSLASRISADTSGYYEKLMVKCV 470 >ref|XP_001556794.1| hypothetical protein BC1G_04812 [Botryotinia fuckeliana B05.10] Length = 476 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 MKG GTKD LV R+V HW P+ Q K AY+H + R L SRI +TSG YEKLMV C+ Sbjct: 404 MKGFGTKDKLLVARVVRCHWDPKHMDQVKGAYQHAYGRSLASRISADTSGYYEKLMVKCV 463 >gb|EMD60368.1| hypothetical protein COCSADRAFT_242065 [Bipolaris sorokiniana ND90Pr] Length = 475 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M G GTKD LV+R+V HW AAYK +K+DL RIEGET GDYE+LMVAC+ Sbjct: 414 MAGLGTKDELLVQRVVRCHWDRNLMNAVSAAYKQVYKKDLVKRIEGETRGDYERLMVACV 473 >ref|XP_001821673.1| annexin XIV-like protein [Aspergillus oryzae RIB40] gi|83769536|dbj|BAE59671.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391867792|gb|EIT77032.1| annexin [Aspergillus oryzae 3.042] Length = 455 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/60 (53%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 +KG GTKD LV R+V +HW+ K Q K AY+H + +DL R+ GETSGDY++LMVA + Sbjct: 395 VKGMGTKDVKLVSRVVRIHWNRAHKDQVKRAYRHRYGKDLIERVRGETSGDYQRLMVALL 454 >ref|XP_002379761.1| SH3 domain protein [Aspergillus flavus NRRL3357] gi|220694641|gb|EED50985.1| SH3 domain protein [Aspergillus flavus NRRL3357] Length = 1103 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/60 (53%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 +KG GTKD LV R+V +HW+ K Q K AY+H + +DL R+ GETSGDY++LMVA + Sbjct: 1043 VKGMGTKDVKLVSRVVRIHWNRAHKDQVKRAYRHRYGKDLIERVRGETSGDYQRLMVALL 1102 >ref|XP_002479586.1| annexin ANXC3.2 [Talaromyces stipitatus ATCC 10500] gi|218719733|gb|EED19152.1| annexin ANXC3.2 [Talaromyces stipitatus ATCC 10500] Length = 706 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -3 Query: 362 MKGAGTKDTALVRRIVMVHWSPERKQQCKAAYKHFHKRDLRSRIEGETSGDYEKLMVACI 183 M GAGTKD LV RIV +HW+ + Q K AY H ++RDLR R++GE SGDY+ LM+A + Sbjct: 646 MAGAGTKDFQLVTRIVRLHWNKQHLDQVKKAYYHHYRRDLRDRVKGEVSGDYQTLMLALL 705