BLASTX nr result
ID: Akebia27_contig00034486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00034486 (729 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30945.3| unnamed protein product [Vitis vinifera] 65 3e-08 ref|XP_002272135.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] 65 3e-08 gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Moru... 64 7e-08 ref|XP_002531431.1| pentatricopeptide repeat-containing protein,... 59 1e-06 gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Mimulus... 59 2e-06 ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 59 2e-06 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 59 2e-06 ref|XP_004293531.1| PREDICTED: pentatricopeptide repeat-containi... 57 8e-06 >emb|CBI30945.3| unnamed protein product [Vitis vinifera] Length = 796 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -3 Query: 160 DLFNRNSRQGG--DSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 DL NS GG + + + ++ESRHPLVREICRLIELR AWNPKLEGELR Sbjct: 133 DLMVLNSFTGGYRQTEGIRRFEGGEDESRHPLVREICRLIELRSAWNPKLEGELR 187 >ref|XP_002272135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Vitis vinifera] Length = 733 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -3 Query: 160 DLFNRNSRQGG--DSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 DL NS GG + + + ++ESRHPLVREICRLIELR AWNPKLEGELR Sbjct: 39 DLMVLNSFTGGYRQTEGIRRFEGGEDESRHPLVREICRLIELRSAWNPKLEGELR 93 >emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] Length = 733 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -3 Query: 160 DLFNRNSRQGG--DSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 DL NS GG + + + ++ESRHPLVREICRLIELR AWNPKLEGELR Sbjct: 39 DLMVLNSFTGGYRQTEGIRRFEGGEDESRHPLVREICRLIELRSAWNPKLEGELR 93 >gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 898 Score = 63.5 bits (153), Expect = 7e-08 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = -3 Query: 166 VLDLFNRNSRQGGDSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 VL+L NRN Q + VG ++E + + RHPLVRE+CRL++LR WNPK EGELR Sbjct: 108 VLNLSNRNIAQREN---VGRIEEDEGQLRHPLVREVCRLVDLRSTWNPKHEGELR 159 >ref|XP_002531431.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528950|gb|EEF30943.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 737 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = -3 Query: 151 NRNSRQGGDSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 N SR G + ++ +EE RHPLVRE+CRLIE R AWN KLEG+LR Sbjct: 46 NSVSRNCGQKEDIWRIEIEEEEFRHPLVREVCRLIERRSAWNAKLEGDLR 95 >gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Mimulus guttatus] Length = 767 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = -3 Query: 169 RVLDLFNRNSRQGGDSGRVGEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 RVL+ F+RN R+ D R EVDE +E RHPLVRE+CRLI LR +W P LE E + Sbjct: 121 RVLNSFDRN-RERSDVSRRIEVDE--DEVRHPLVREVCRLIGLRASWTPNLESEFK 173 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Citrus sinensis] Length = 837 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 DEESRHPLVREICRLIELRQAWNPKLEGELR 2 ++E RHPLVRE+CRLIELR AW+PKLEGELR Sbjct: 165 EDEFRHPLVREVCRLIELRSAWSPKLEGELR 195 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 94 DEESRHPLVREICRLIELRQAWNPKLEGELR 2 ++E RHPLVRE+CRLIELR AW+PKLEGELR Sbjct: 165 EDEFRHPLVREVCRLIELRSAWSPKLEGELR 195 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 7/50 (14%) Frame = -3 Query: 130 GDSGRVGE-------VDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 G S RV E V+ ++E RHPLVRE+CRL+ELR WNPKLEG+LR Sbjct: 111 GSSNRVHEQKENFVRVEGDEDEFRHPLVREVCRLLELRSGWNPKLEGQLR 160 >ref|XP_004293531.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 734 Score = 56.6 bits (135), Expect = 8e-06 Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = -3 Query: 151 NRNSRQGGDSGRV-GEVDELDEESRHPLVREICRLIELRQAWNPKLEGELR 2 NR + G GRV G D ++E RHPLVRE+ RLIE+R AW PK EGELR Sbjct: 42 NRVCEERGKLGRVEGGGDGDEDEYRHPLVREVGRLIEMRTAWTPKFEGELR 92