BLASTX nr result
ID: Akebia27_contig00034033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00034033 (565 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS73418.1| hypothetical protein PFICI_15023 [Pestalotiopsis ... 68 1e-09 >gb|ETS73418.1| hypothetical protein PFICI_15023 [Pestalotiopsis fici W106-1] Length = 334 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = -3 Query: 326 KSVHNVYPV-KRESDKEQK--SEKSGNSKQEGGNNGGNAIAVPAVVQAQSTEIIIIWANP 156 KSVHNVYPV KRE DK K S+ S N+K NN N AVP +VQA +TEIII+W NP Sbjct: 18 KSVHNVYPVAKREDDKSNKDNSKDSKNNKNNNNNNNNNN-AVPIIVQAATTEIIILWNNP 76 Query: 155 GN 150 GN Sbjct: 77 GN 78