BLASTX nr result
ID: Akebia27_contig00033763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00033763 (1035 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235160.1| PREDICTED: luc7-like protein 3-like [Solanum... 60 2e-06 ref|XP_006358255.1| PREDICTED: luc7-like protein 3-like isoform ... 58 7e-06 ref|XP_007038382.1| LUC7 N_terminus domain-containing protein is... 57 9e-06 >ref|XP_004235160.1| PREDICTED: luc7-like protein 3-like [Solanum lycopersicum] Length = 355 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 948 SFEKSPKHDSYVPKFEAELAHFCEKLV 1028 SFEKSP+HDSYVPKFEAELAHFCEKLV Sbjct: 71 SFEKSPRHDSYVPKFEAELAHFCEKLV 97 >ref|XP_006358255.1| PREDICTED: luc7-like protein 3-like isoform X1 [Solanum tuberosum] gi|565384683|ref|XP_006358256.1| PREDICTED: luc7-like protein 3-like isoform X2 [Solanum tuberosum] Length = 359 Score = 57.8 bits (138), Expect = 7e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 948 SFEKSPKHDSYVPKFEAELAHFCEKLV 1028 SFEKSP+HDS+VPKFEAELAHFCEKLV Sbjct: 71 SFEKSPRHDSHVPKFEAELAHFCEKLV 97 >ref|XP_007038382.1| LUC7 N_terminus domain-containing protein isoform 3 [Theobroma cacao] gi|508775627|gb|EOY22883.1| LUC7 N_terminus domain-containing protein isoform 3 [Theobroma cacao] Length = 291 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 939 FVFSFEKSPKHDSYVPKFEAELAHFCEKLV 1028 F SFEKSP+HD+YVPKFEAELA FCEKLV Sbjct: 8 FFLSFEKSPRHDAYVPKFEAELAQFCEKLV 37