BLASTX nr result
ID: Akebia27_contig00033492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00033492 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005647180.1| hypothetical protein COCSUDRAFT_66322 [Cocco... 67 3e-09 >ref|XP_005647180.1| hypothetical protein COCSUDRAFT_66322 [Coccomyxa subellipsoidea C-169] gi|384249154|gb|EIE22636.1| hypothetical protein COCSUDRAFT_66322 [Coccomyxa subellipsoidea C-169] Length = 131 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/71 (46%), Positives = 44/71 (61%) Frame = +2 Query: 11 WAEPSNKNPLEKQTLTRQGITGQSKGLKDESAINAEEVKQGTQDAADGAKNKLQEAGDAI 190 WAEP N NPLEK TL+R+G QSK +KDE +N + +G +DAAD K +++A D + Sbjct: 63 WAEPKNNNPLEKTTLSREGFGKQSKQMKDEQEVN--KFTEGVKDAADNVKEGVKDAADKV 120 Query: 191 AGAVDKINPAK 223 A A K K Sbjct: 121 ADAAKKATGQK 131