BLASTX nr result
ID: Akebia27_contig00033285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00033285 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME82188.1| hypothetical protein MYCFIDRAFT_215607 [Pseudocer... 62 1e-07 gb|EMC93960.1| hypothetical protein BAUCODRAFT_216599 [Baudoinia... 56 6e-06 >gb|EME82188.1| hypothetical protein MYCFIDRAFT_215607 [Pseudocercospora fijiensis CIRAD86] Length = 390 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -3 Query: 147 MFSKTVIAAVAATLFTTTN-AHFFITNPAPVPGSNSKSPLDPSGSNFPC 4 M S AA+AATL +T + AH FI++P+P+PGS K PLDPSGSNFPC Sbjct: 3 MLSIPFKAALAATLLSTPSVAHMFISSPSPIPGSAPKDPLDPSGSNFPC 51 >gb|EMC93960.1| hypothetical protein BAUCODRAFT_216599 [Baudoinia compniacensis UAMH 10762] Length = 424 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 99 TTNAHFFITNPAPVPGSNSKSPLDPSGSNFPC 4 T NAH FI++PAP+PGS K PLD SGSNFPC Sbjct: 18 TVNAHMFISSPAPIPGSAPKDPLDASGSNFPC 49