BLASTX nr result
ID: Akebia27_contig00032944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032944 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849539.1| hypothetical protein AMTR_s00024p00164620 [A... 58 2e-06 >ref|XP_006849539.1| hypothetical protein AMTR_s00024p00164620 [Amborella trichopoda] gi|548853114|gb|ERN11120.1| hypothetical protein AMTR_s00024p00164620 [Amborella trichopoda] Length = 305 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/38 (76%), Positives = 33/38 (86%), Gaps = 3/38 (7%) Frame = +1 Query: 337 SARGFDVNQLPSTEDGD---AVSSPNSTVSSFQIDFSI 441 S RGFDVN +PSTEDGD AVSSPNSTVSSFQ+DF++ Sbjct: 82 STRGFDVNLIPSTEDGDEETAVSSPNSTVSSFQMDFAM 119