BLASTX nr result
ID: Akebia27_contig00032711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032711 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_010528056.1| fasciclin [Thermophagus xiamenensis] 58 1e-06 ref|WP_010664378.1| fasciclin [Marinilabilia salmonicolor] 55 8e-06 >ref|WP_010528056.1| fasciclin [Thermophagus xiamenensis] Length = 448 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +1 Query: 190 PAGDETVFDVAEAN-GLTLLVDAAQLDSLDSSLDNTTLAYTVFAPTNDAFEALLSENGFS 366 P T+ DVA A+ ++L+DA +L L +L + YTVFAPTNDAF LL+E G+ Sbjct: 33 PDESNTIVDVASADENFSVLIDALELTDLKDALADENAEYTVFAPTNDAFSDLLTELGYD 92 Query: 367 DLED 378 +LED Sbjct: 93 ELED 96 >ref|WP_010664378.1| fasciclin [Marinilabilia salmonicolor] Length = 450 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/64 (48%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 190 PAGDETVFDVAEANG-LTLLVDAAQLDSLDSSLDNTTLAYTVFAPTNDAFEALLSENGFS 366 P T+ DVA N ++LVDA LD +L ++TVFAPTNDAF ALL+E G S Sbjct: 35 PVESNTIVDVASGNDDFSILVDALVKTGLDDALAAEDASFTVFAPTNDAFVALLNELGVS 94 Query: 367 DLED 378 L+D Sbjct: 95 GLDD 98