BLASTX nr result
ID: Akebia27_contig00032675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032675 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77166.1| hypothetical protein VITISV_029835 [Vitis vinifera] 40 1e-06 emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] 42 4e-06 emb|CAN77234.1| hypothetical protein VITISV_010061 [Vitis vinifera] 41 5e-06 emb|CAN78583.1| hypothetical protein VITISV_029931 [Vitis vinifera] 43 5e-06 emb|CAN81329.1| hypothetical protein VITISV_039333 [Vitis vinifera] 39 5e-06 emb|CAN77480.1| hypothetical protein VITISV_021632 [Vitis vinifera] 38 1e-05 >emb|CAN77166.1| hypothetical protein VITISV_029835 [Vitis vinifera] Length = 1680 Score = 39.7 bits (91), Expect(2) = 1e-06 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 165 LEGNQEACFPSSSIWASKVPSKVFFFFMWLAALNKLPTVDLFKRK 299 L G+ FP+ IW KVP+KV FF W A+ K+ T+D +R+ Sbjct: 1561 LSGSSAGVFPNRRIWMDKVPTKV-SFFAWEASWGKILTLDKLQRR 1604 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 14/51 (27%), Positives = 30/51 (58%) Frame = +1 Query: 409 WKIPSIHVIHRLKASGEFVDHVLIHCELAFVVWSHFLSLFKVTWCFPCSIV 561 W++P+ ++ + E +H+L+HC + +W L++F V W FP +++ Sbjct: 1606 WQLPNRCFLYGYEE--ESANHILLHCTMVKTIWEITLAIFGVQWVFPETVI 1654 >emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] Length = 843 Score = 41.6 bits (96), Expect(2) = 4e-06 Identities = 20/54 (37%), Positives = 32/54 (59%) Frame = +1 Query: 409 WKIPSIHVIHRLKASGEFVDHVLIHCELAFVVWSHFLSLFKVTWCFPCSIVPLL 570 W++P+ + + E VDH+LIHC + V+W L+LF V W FP ++ +L Sbjct: 452 WQLPNCCFL--CGSEEESVDHLLIHCIVVRVLWDLVLALFGVHWVFPETVKKVL 503 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 189 FPSSSIWASKVPSKVFFFFMWLAALNKLPTVDLFKRK 299 FP +SIW VP+K+ FF W A K+ T+D +R+ Sbjct: 415 FPKNSIWVESVPTKL-AFFAWEATWGKVLTLDRLQRR 450 >emb|CAN77234.1| hypothetical protein VITISV_010061 [Vitis vinifera] Length = 3216 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 22/47 (46%), Positives = 27/47 (57%) Frame = +3 Query: 189 FPSSSIWASKVPSKVFFFFMWLAALNKLPTVDLFKRKDLILVDYFCL 329 FP IW+ VPSKV FF W A+ K+ T D KR+ IL + CL Sbjct: 1543 FPGKIIWSPYVPSKVSFF-AWEASWEKVLTQDQLKRRGWILANRXCL 1588 Score = 35.4 bits (80), Expect(2) = 5e-06 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 448 ASGEFVDHVLIHCELAFVVWSHFLSLFKVTWCFPCSI 558 A E ++ +L+HC ++W SLF V W P S+ Sbjct: 1591 AEEETINRILVHCSKTKILWDLVFSLFGVNWVLPFSV 1627 >emb|CAN78583.1| hypothetical protein VITISV_029931 [Vitis vinifera] Length = 1875 Score = 42.7 bits (99), Expect(2) = 5e-06 Identities = 19/54 (35%), Positives = 32/54 (59%) Frame = +1 Query: 409 WKIPSIHVIHRLKASGEFVDHVLIHCELAFVVWSHFLSLFKVTWCFPCSIVPLL 570 W++P+ + E V H+L+HC +A V+W L+LF V W FP +++ +L Sbjct: 1745 WQLPNCCFL--CGCEEENVHHILLHCTVARVLWDIILALFGVHWVFPETVIEVL 1796 Score = 33.5 bits (75), Expect(2) = 5e-06 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 189 FPSSSIWASKVPSKVFFFFMWLAALNKLPTVDLFKRK 299 FP IW KVP+K FF W A K+ T+D +R+ Sbjct: 1708 FPVRCIWVDKVPTKA-AFFAWEATWGKILTLDRLQRR 1743 >emb|CAN81329.1| hypothetical protein VITISV_039333 [Vitis vinifera] Length = 174 Score = 39.3 bits (90), Expect(2) = 5e-06 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +1 Query: 409 WKIPSIHVIHRLKASGEFVDHVLIHCELAFVVWSHFLSLFKVTWCFPCSIVPLL 570 W++P++ + E V+H+LIHC +A V+W +LF V W F ++ +L Sbjct: 121 WQLPNLCFL--CGCEEESVNHILIHCIVAKVLWDMIFALFGVQWVFSETVKEVL 172 Score = 37.0 bits (84), Expect(2) = 5e-06 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 189 FPSSSIWASKVPSKVFFFFMWLAALNKLPTVDLFKRK 299 FP S+IW KVP+K+ FF W A K+ T+D +++ Sbjct: 84 FPKSNIWVDKVPTKI-LFFAWEATWGKVFTLDRLQKR 119 >emb|CAN77480.1| hypothetical protein VITISV_021632 [Vitis vinifera] Length = 2706 Score = 38.1 bits (87), Expect(2) = 1e-05 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = +1 Query: 409 WKIPSIHVIHRLKASGEFVDHVLIHCELAFVVWSHFLSLFKVTWCFPCSI 558 W +P+ ++ + E ++H+LIHC +A +W+ L+L V W FP S+ Sbjct: 2182 WHLPNRCFLYGCEE--ETINHILIHCTVAKGLWNIILALCGVQWVFPNSV 2229 Score = 37.0 bits (84), Expect(2) = 1e-05 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 189 FPSSSIWASKVPSKVFFFFMWLAALNKLPTVDLFKRK 299 FP S++W KVP+K+ FF W A K+ T+D +R+ Sbjct: 2145 FPHSNVWVGKVPTKI-AFFAWEATWGKVLTLDRLQRR 2180