BLASTX nr result
ID: Akebia27_contig00032629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032629 (1186 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362709.1| PREDICTED: putative ribonuclease H protein A... 47 3e-06 >ref|XP_006362709.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 217 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +3 Query: 411 PSSLCSVLEVWHSHGVSFSASKRILWIPFAIFWGIWKERNVYSVEGPEHSLQEI 572 P S+ VL+ W+ G + KR +P I+W IWKERN EG ++++Q+I Sbjct: 134 PGSIIEVLQCWNRDGNAGKNEKRWRIVPACIWWTIWKERNQRCFEGKQNNIQKI 187 Score = 32.3 bits (72), Expect(2) = 3e-06 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 284 PWMPSFYSMCKSDGESVGYLFVHCKLAHNMWYLF 385 P + S +C+ E+V +LF+HCK +W +F Sbjct: 90 PNLRSSCYLCEEQVETVNHLFLHCKWTDQLWQMF 123