BLASTX nr result
ID: Akebia27_contig00032243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032243 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9LLA7.1|AP32_ASAEU RecName: Full=MADS-box protein AeAP3-2; A... 73 4e-11 gb|AAR87687.1| B-sister lineage-like protein BS [Drimys winteri] 66 6e-09 gb|AAR87674.1| B-sister lineage-like protein BS [Aquilegia alpina] 64 2e-08 gb|ADD25186.1| Bsister2 [Cabomba caroliniana] 55 8e-06 gb|ADD25185.1| Bsister1 [Cabomba caroliniana] 55 8e-06 >sp|Q9LLA7.1|AP32_ASAEU RecName: Full=MADS-box protein AeAP3-2; AltName: Full=APETALA3-2 gi|8163938|gb|AAF73927.1|AF230698_1 MADS box transcription factor AP3-2 [Asarum europaeum] Length = 210 Score = 73.2 bits (178), Expect = 4e-11 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 3/63 (4%) Frame = -3 Query: 345 AVMENKVVEQPILLDHFGLY--PDDQATRN-MLQLSPQLHPYRLQPSQPNPQEASLLRHG 175 A ME K+V+ P +LDHFG++ D QA R+ MLQLSPQLHP+RLQP+QPN Q+A+LL H Sbjct: 149 ASMEQKMVD-PSMLDHFGVFYQDDHQAARSSMLQLSPQLHPFRLQPAQPNLQDANLLPHD 207 Query: 174 LQL 166 LQL Sbjct: 208 LQL 210 >gb|AAR87687.1| B-sister lineage-like protein BS [Drimys winteri] Length = 203 Score = 65.9 bits (159), Expect = 6e-09 Identities = 37/56 (66%), Positives = 44/56 (78%), Gaps = 3/56 (5%) Frame = -3 Query: 345 AVMENKVVEQPILLDHFGL---YPDDQATRNMLQLSPQLHPYRLQPSQPNPQEASL 187 A ME KVV+QP +LDHFG Y D+QA RNMLQLSPQLH +RLQP+Q N Q+A+L Sbjct: 148 ASMEQKVVDQP-MLDHFGALLAYQDEQA-RNMLQLSPQLHAFRLQPTQSNLQDANL 201 >gb|AAR87674.1| B-sister lineage-like protein BS [Aquilegia alpina] Length = 218 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 3/63 (4%) Frame = -3 Query: 345 AVMENKVVEQPILLDHFGLYPDDQATRNMLQLSP---QLHPYRLQPSQPNPQEASLLRHG 175 A+ME+KV E P +L+HFGLY D+ RN+LQLSP QLH +RLQP+QPN QE L Sbjct: 158 AMMEHKV-EHP-MLEHFGLYATDEQARNLLQLSPLSPQLHTFRLQPTQPNLQERGLQYPD 215 Query: 174 LQL 166 LQL Sbjct: 216 LQL 218 >gb|ADD25186.1| Bsister2 [Cabomba caroliniana] Length = 225 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 4/63 (6%) Frame = -3 Query: 342 VMENKV-VEQPI-LLDHFG-LYPDDQATRNMLQLSPQLHPYRLQPSQPNPQE-ASLLRHG 175 VME KV E P+ LLD+FG LY DDQ+ R MLQL P +RLQP+QPN Q+ A++ HG Sbjct: 164 VMETKVSAETPVQLLDYFGSLYHDDQS-REMLQLIPPFPNFRLQPTQPNLQDHAAVHHHG 222 Query: 174 LQL 166 LQL Sbjct: 223 LQL 225 >gb|ADD25185.1| Bsister1 [Cabomba caroliniana] Length = 225 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 4/63 (6%) Frame = -3 Query: 342 VMENKVV-EQPI-LLDHFG-LYPDDQATRNMLQLSPQLHPYRLQPSQPNPQE-ASLLRHG 175 VME KV E P+ LLD+FG LY DDQ+ R MLQLSP +RLQP+QPN Q+ A++ H Sbjct: 164 VMEPKVAAETPVQLLDYFGSLYQDDQS-RGMLQLSPPFPNFRLQPTQPNLQDHAAIHHHS 222 Query: 174 LQL 166 LQL Sbjct: 223 LQL 225