BLASTX nr result
ID: Akebia27_contig00032215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032215 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG17948.1| Heat shock protein 9/12 [Macrophomina phaseolina ... 59 9e-07 >gb|EKG17948.1| Heat shock protein 9/12 [Macrophomina phaseolina MS6] Length = 128 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 3 QKSTLDQAKEGGSGVYDKAAGTVQPNDQKSATQKAGDTL 119 QKSTLD+A E SG YD+AAG +QP+DQKSATQKA D+L Sbjct: 51 QKSTLDKAGESLSGTYDRAAGALQPDDQKSATQKASDSL 89