BLASTX nr result
ID: Akebia27_contig00032053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00032053 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511959.1| protein with unknown function [Ricinus commu... 59 7e-07 gb|EXB56943.1| Aspartic proteinase Asp1 [Morus notabilis] 58 1e-06 >ref|XP_002511959.1| protein with unknown function [Ricinus communis] gi|223549139|gb|EEF50628.1| protein with unknown function [Ricinus communis] Length = 583 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 3 SLRGQLVVYDNVNEKIGWIRSDCVKPPTRFESFPFF 110 SLRGQL++YDNVN KIGW +SDC+KP T F + PFF Sbjct: 547 SLRGQLIIYDNVNNKIGWTQSDCIKPKT-FSTLPFF 581 >gb|EXB56943.1| Aspartic proteinase Asp1 [Morus notabilis] Length = 569 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 3 SLRGQLVVYDNVNEKIGWIRSDCVKPPTRFESFPFF 110 SLRG LVVYDN N+KIGW SDCVK P RF+S PFF Sbjct: 534 SLRGHLVVYDNENQKIGWTNSDCVK-PRRFDSLPFF 568