BLASTX nr result
ID: Akebia27_contig00031857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031857 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72053.1| hypothetical protein VITISV_031314 [Vitis vinifera] 40 2e-06 >emb|CAN72053.1| hypothetical protein VITISV_031314 [Vitis vinifera] Length = 780 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -3 Query: 312 GMGSAARLILEKA*ECVSWSFLDYMLGRMDFGAKCSKWV*VCEATLLF 169 G G +L +EKA + V+WSFL +++ M FGAK W+ C T+ F Sbjct: 437 GGGILCKLDIEKAYDHVNWSFLLWLMEMMGFGAKWISWIQWCIGTVSF 484 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -1 Query: 173 FSYLVKGFLISFFRSSTRSMQWDPQSCFWFIVMFEIL 63 FS L+ G L+ F +SS QWDP S + F+++ E L Sbjct: 484 FSVLINGTLLGFSQSSRGLRQWDPLSPYLFVIVMEAL 520