BLASTX nr result
ID: Akebia27_contig00031786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031786 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001588849.1| hypothetical protein SS1G_10397 [Sclerotinia... 59 9e-07 >ref|XP_001588849.1| hypothetical protein SS1G_10397 [Sclerotinia sclerotiorum 1980] gi|154694785|gb|EDN94523.1| hypothetical protein SS1G_10397 [Sclerotinia sclerotiorum 1980 UF-70] Length = 155 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/75 (38%), Positives = 40/75 (53%) Frame = -1 Query: 278 ASVKEHMVGPEGPLRPQDPARKAGAWRQTVGSTTEMWGEMVGSERLKKKGKEQRXXXXXX 99 ASV + V G + DPAR+ G+W QT+GS E G M+G+E L+K+G+EQ Sbjct: 54 ASVGGYSVSSSGAISENDPARQEGSWNQTIGSGKEFIGGMLGAEELRKEGREQNAAGRGQ 113 Query: 98 XXXXXERDTGTGFGD 54 D G+G D Sbjct: 114 QAQGQLNDLGSGVKD 128