BLASTX nr result
ID: Akebia27_contig00031632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031632 (897 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526569.1| oligopeptide transporter, putative [Ricinus ... 59 2e-06 >ref|XP_002526569.1| oligopeptide transporter, putative [Ricinus communis] gi|223534130|gb|EEF35847.1| oligopeptide transporter, putative [Ricinus communis] Length = 516 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -2 Query: 494 VKPEPISQHS*LSMLISLVIYDRYFVLATRRHKKNPKGITLLQSMEMG 351 + P +S + MLISLV+YDRYFVLA RR+ KNP+GITLLQ M +G Sbjct: 297 IPPACLSAFMTIFMLISLVLYDRYFVLAVRRYTKNPRGITLLQRMGIG 344