BLASTX nr result
ID: Akebia27_contig00031523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031523 (904 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG06507.1| ribosomal protein L22 [Stauntonia hexaphylla] 64 1e-07 dbj|BAG06440.1| ribosomal protein L22 [Elaeagnus formosana] 59 2e-06 ref|YP_001019178.1| ribosomal protein L22 [Ranunculus macranthus... 59 2e-06 >dbj|BAG06507.1| ribosomal protein L22 [Stauntonia hexaphylla] Length = 168 Score = 63.5 bits (153), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 625 KKSTCHITIVLQDISKDPKYFIWLRKYRWM 714 KK TCHITIVLQDISKDPKYFIWLRKY W+ Sbjct: 104 KKPTCHITIVLQDISKDPKYFIWLRKYGWI 133 >dbj|BAG06440.1| ribosomal protein L22 [Elaeagnus formosana] Length = 179 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 625 KKSTCHITIVLQDISKDPKYFIWLRKYRWM 714 K+ TCHITIVLQDISKD KYFIWLRKY W+ Sbjct: 104 KRPTCHITIVLQDISKDKKYFIWLRKYGWV 133 >ref|YP_001019178.1| ribosomal protein L22 [Ranunculus macranthus] gi|215274766|sp|A2CHX2.1|RK22_RANMC RecName: Full=50S ribosomal protein L22, chloroplastic gi|124074980|gb|ABM90427.1| ribosomal protein L22 [Ranunculus macranthus] Length = 179 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 625 KKSTCHITIVLQDISKDPKYFIWLRKYRWM 714 K+ TCHITIVLQDISKD KYFIWLRKY W+ Sbjct: 104 KRPTCHITIVLQDISKDKKYFIWLRKYGWI 133