BLASTX nr result
ID: Akebia27_contig00031504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031504 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25969.1| hypothetical protein MIMGU_mgv1a001127mg [Mimulus... 65 1e-08 ref|XP_006424062.1| hypothetical protein CICLE_v10027791mg [Citr... 64 3e-08 ref|XP_006361109.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 9e-08 ref|XP_003632213.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 1e-07 emb|CBI24406.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_004241355.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 61 2e-07 ref|XP_002299762.2| ubiquitin-specific protease 8 family protein... 60 3e-07 ref|XP_007207199.1| hypothetical protein PRUPE_ppa002864mg [Prun... 59 8e-07 ref|XP_003596922.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 59 1e-06 ref|XP_002874042.1| ubiquitin carboxyl-terminal hydrolase 8 [Ara... 59 1e-06 ref|XP_004291525.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 1e-06 ref|XP_006664758.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 2e-06 ref|XP_004487441.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 2e-06 ref|XP_004487440.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 2e-06 ref|XP_006592793.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 3e-06 ref|XP_006592792.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 3e-06 ref|XP_006592791.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 3e-06 ref|XP_007150003.1| hypothetical protein PHAVU_005G117700g [Phas... 57 3e-06 ref|XP_003543403.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 3e-06 ref|XP_003540267.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 3e-06 >gb|EYU25969.1| hypothetical protein MIMGU_mgv1a001127mg [Mimulus guttatus] Length = 882 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQDA 433 ++W+DFDDSHV P+S DKIKTSAAYVLFYRRV+DA Sbjct: 848 DRWYDFDDSHVSPISEDKIKTSAAYVLFYRRVEDA 882 >ref|XP_006424062.1| hypothetical protein CICLE_v10027791mg [Citrus clementina] gi|568869238|ref|XP_006487835.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Citrus sinensis] gi|557525996|gb|ESR37302.1| hypothetical protein CICLE_v10027791mg [Citrus clementina] Length = 883 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 534 QWFDFDDSHVFPVSGDKIKTSAAYVLFYRRV 442 QW+DFDDSHV+P+S DKIKTSAAYVLFYRRV Sbjct: 849 QWYDFDDSHVYPISQDKIKTSAAYVLFYRRV 879 >ref|XP_006361109.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Solanum tuberosum] Length = 875 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 ++W+DFDDSHV P+S DKIKTSAAYVLFYRRV++ Sbjct: 841 DRWYDFDDSHVSPISKDKIKTSAAYVLFYRRVEE 874 >ref|XP_003632213.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Vitis vinifera] Length = 882 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 +QW+DFDDSHV P+ DKIKTSAAYVLFYRRV D Sbjct: 848 DQWYDFDDSHVSPIPEDKIKTSAAYVLFYRRVVD 881 >emb|CBI24406.3| unnamed protein product [Vitis vinifera] Length = 921 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 +QW+DFDDSHV P+ DKIKTSAAYVLFYRRV D Sbjct: 887 DQWYDFDDSHVSPIPEDKIKTSAAYVLFYRRVVD 920 >ref|XP_004241355.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Solanum lycopersicum] Length = 875 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 ++W+DFDDSHV P++ DKIKTSAAYVLFYRRV++ Sbjct: 841 DRWYDFDDSHVSPINKDKIKTSAAYVLFYRRVEE 874 >ref|XP_002299762.2| ubiquitin-specific protease 8 family protein [Populus trichocarpa] gi|550347881|gb|EEE84567.2| ubiquitin-specific protease 8 family protein [Populus trichocarpa] Length = 647 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRV 442 +QW+DFDDSHV P+S +KIKTSAAYVLFYRRV Sbjct: 614 DQWYDFDDSHVSPISQEKIKTSAAYVLFYRRV 645 >ref|XP_007207199.1| hypothetical protein PRUPE_ppa002864mg [Prunus persica] gi|462402841|gb|EMJ08398.1| hypothetical protein PRUPE_ppa002864mg [Prunus persica] Length = 626 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRV 442 ++W+DFDDSHV PVS DKIK+SAAYVLFYRRV Sbjct: 592 DRWYDFDDSHVNPVSQDKIKSSAAYVLFYRRV 623 >ref|XP_003596922.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355485970|gb|AES67173.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 871 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 +QW+DFDDS V+P+S +KIK+SAAYVLFYRRV + Sbjct: 831 DQWYDFDDSRVYPISKEKIKSSAAYVLFYRRVSE 864 >ref|XP_002874042.1| ubiquitin carboxyl-terminal hydrolase 8 [Arabidopsis lyrata subsp. lyrata] gi|297319879|gb|EFH50301.1| ubiquitin carboxyl-terminal hydrolase 8 [Arabidopsis lyrata subsp. lyrata] Length = 891 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 ++W+DFDDSHV P+S +KIKTSAAYVLFY+R+ D Sbjct: 858 DRWYDFDDSHVHPISQEKIKTSAAYVLFYKRLVD 891 >ref|XP_004291525.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Fragaria vesca subsp. vesca] Length = 885 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRV 442 ++W+DFDDSHV PVS DKIK++AAYVLFYRRV Sbjct: 851 DRWYDFDDSHVSPVSQDKIKSAAAYVLFYRRV 882 >ref|XP_006664758.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Oryza brachyantha] Length = 862 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 531 WFDFDDSHVFPVSGDKIKTSAAYVLFYRRVQD 436 W+DFDD HV P+S + IKTSAAYVLFYRR+QD Sbjct: 814 WYDFDDRHVGPISEESIKTSAAYVLFYRRIQD 845 >ref|XP_004487441.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X2 [Cicer arietinum] Length = 873 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRV 442 +QW+DFDDS V+P+S +KIK+SAAYVLFYRRV Sbjct: 837 DQWYDFDDSRVYPISKEKIKSSAAYVLFYRRV 868 >ref|XP_004487440.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X1 [Cicer arietinum] Length = 870 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRRV 442 +QW+DFDDS V+P+S +KIK+SAAYVLFYRRV Sbjct: 834 DQWYDFDDSRVYPISKEKIKSSAAYVLFYRRV 865 >ref|XP_006592793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X4 [Glycine max] Length = 768 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRR 445 +QW+DFDDSHV P+S +KIK+SAAYVLFYRR Sbjct: 732 DQWYDFDDSHVNPISKEKIKSSAAYVLFYRR 762 >ref|XP_006592792.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X3 [Glycine max] Length = 836 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRR 445 +QW+DFDDSHV P+S +KIK+SAAYVLFYRR Sbjct: 800 DQWYDFDDSHVNPISKEKIKSSAAYVLFYRR 830 >ref|XP_006592791.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X2 [Glycine max] Length = 837 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRR 445 +QW+DFDDSHV P+S +KIK+SAAYVLFYRR Sbjct: 801 DQWYDFDDSHVNPISKEKIKSSAAYVLFYRR 831 >ref|XP_007150003.1| hypothetical protein PHAVU_005G117700g [Phaseolus vulgaris] gi|561023267|gb|ESW21997.1| hypothetical protein PHAVU_005G117700g [Phaseolus vulgaris] Length = 872 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRR 445 +QW+DFDDSHV P+S +KIK+SAAYVLFYRR Sbjct: 836 DQWYDFDDSHVNPISKEKIKSSAAYVLFYRR 866 >ref|XP_003543403.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Glycine max] Length = 872 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRR 445 +QW+DFDDSHV+P+ +KIK+SAAYVLFYRR Sbjct: 836 DQWYDFDDSHVYPIIKEKIKSSAAYVLFYRR 866 >ref|XP_003540267.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like isoform X1 [Glycine max] Length = 874 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 537 NQWFDFDDSHVFPVSGDKIKTSAAYVLFYRR 445 +QW+DFDDSHV P+S +KIK+SAAYVLFYRR Sbjct: 838 DQWYDFDDSHVNPISKEKIKSSAAYVLFYRR 868