BLASTX nr result
ID: Akebia27_contig00031183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031183 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001147249.1| metallothionein-like protein type 2 [Zea may... 59 5e-07 ref|NP_001150795.1| metallothionein-like protein type 2 [Zea may... 59 9e-07 gb|AFK42171.1| unknown [Lotus japonicus] 58 1e-06 gb|ACG42263.1| metallothionein-like protein type 2 [Zea mays] gi... 58 1e-06 gb|ACG32329.1| metallothionein-like protein type 2 [Zea mays] gi... 58 1e-06 ref|NP_001148019.1| metallothionein-like protein type 2 [Zea may... 58 1e-06 ref|NP_001147621.1| metallothionein-like protein type 2 [Zea may... 58 1e-06 dbj|BAD18379.1| type 2 metallothionein [Vigna angularis] 56 4e-06 gb|AAV50043.1| metallothionein-like protein [Saccharum hybrid cu... 56 6e-06 dbj|BAD18383.1| type 2 metallothionein [Pisum sativum] 55 8e-06 emb|CAE12162.1| metallothionein-like protein [Quercus robur] 55 8e-06 sp|Q41657.1|MT2_VICFA RecName: Full=Metallothionein-like protein... 55 8e-06 dbj|BAF35950.1| metallothionein [Coptis japonica] 55 8e-06 tpg|DAA53462.1| TPA: putative metallothionein famil protein, par... 55 1e-05 gb|ACG34277.1| metallothionein-like protein type 2 [Zea mays] 55 1e-05 gb|ACG33636.1| metallothionein-like protein type 2 [Zea mays] 55 1e-05 >ref|NP_001147249.1| metallothionein-like protein type 2 [Zea mays] gi|195604198|gb|ACG23929.1| metallothionein-like protein type 2 [Zea mays] gi|195609092|gb|ACG26376.1| metallothionein-like protein type 2 [Zea mays] gi|195658135|gb|ACG48535.1| metallothionein-like protein type 2 [Zea mays] gi|300216395|gb|ADJ79933.1| metallothionein [Acacia auriculiformis] Length = 75 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 137 TKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +KG + AGAEN GCKCGANCTCDPCTCK Sbjct: 46 SKGGFVAAAGAENGGCKCGANCTCDPCTCK 75 >ref|NP_001150795.1| metallothionein-like protein type 2 [Zea mays] gi|195619866|gb|ACG31763.1| metallothionein-like protein type 2 [Zea mays] gi|195636910|gb|ACG37923.1| metallothionein-like protein type 2 [Zea mays] gi|195641920|gb|ACG40428.1| metallothionein-like protein type 2 [Zea mays] Length = 78 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 137 TKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +KG AGAEN GCKCGANCTCDPCTCK Sbjct: 49 SKGGVEAAAGAENGGCKCGANCTCDPCTCK 78 >gb|AFK42171.1| unknown [Lotus japonicus] Length = 95 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 140 KGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +G+EM A AEN GCKCG+NCTCDPCTCK Sbjct: 52 EGAEMGVAAAENGGCKCGSNCTCDPCTCK 80 >gb|ACG42263.1| metallothionein-like protein type 2 [Zea mays] gi|414876420|tpg|DAA53551.1| TPA: putative metallothionein famil protein [Zea mays] Length = 75 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 137 TKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +KG AGAEN GCKCGANCTCDPCTCK Sbjct: 46 SKGGFEAAAGAENGGCKCGANCTCDPCTCK 75 >gb|ACG32329.1| metallothionein-like protein type 2 [Zea mays] gi|195646550|gb|ACG42743.1| metallothionein-like protein type 2 [Zea mays] Length = 52 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 137 TKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +KG AGAEN GCKCGANCTCDPCTCK Sbjct: 23 SKGGFEAAAGAENGGCKCGANCTCDPCTCK 52 >ref|NP_001148019.1| metallothionein-like protein type 2 [Zea mays] gi|195615182|gb|ACG29421.1| metallothionein-like protein type 2 [Zea mays] Length = 76 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 137 TKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +KG AGAEN GCKCGANCTCDPCTCK Sbjct: 47 SKGGFEAAAGAENGGCKCGANCTCDPCTCK 76 >ref|NP_001147621.1| metallothionein-like protein type 2 [Zea mays] gi|195612608|gb|ACG28134.1| metallothionein-like protein type 2 [Zea mays] Length = 78 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 137 TKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +KG AGAEN GCKCGANCTCDPCTCK Sbjct: 49 SKGGFEAAAGAENGGCKCGANCTCDPCTCK 78 >dbj|BAD18379.1| type 2 metallothionein [Vigna angularis] Length = 79 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 128 EVSTKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +V +G+EM AG ENDGCKCG+NCTC+PCTCK Sbjct: 48 KVQFEGAEMGVAG-ENDGCKCGSNCTCNPCTCK 79 >gb|AAV50043.1| metallothionein-like protein [Saccharum hybrid cultivar Pindar] gi|145206743|gb|ABP37784.1| metallothinein-like protein [Saccharum officinarum] Length = 81 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 143 GSEMMTAGAENDGCKCGANCTCDPCTCK 226 G E AGAENDGCKCG NC+C+PCTCK Sbjct: 54 GFEAAAAGAENDGCKCGPNCSCNPCTCK 81 >dbj|BAD18383.1| type 2 metallothionein [Pisum sativum] Length = 77 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +2 Query: 149 EMMTAGAENDGCKCGANCTCDPCTCK 226 E GAENDGCKCGANCTC+PCTCK Sbjct: 52 ESAEMGAENDGCKCGANCTCNPCTCK 77 >emb|CAE12162.1| metallothionein-like protein [Quercus robur] Length = 98 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 128 EVSTKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 ++ ++GSEM + GAEN GCKCG+NCTCDPC CK Sbjct: 67 KIYSEGSEM-SFGAENGGCKCGSNCTCDPCNCK 98 >sp|Q41657.1|MT2_VICFA RecName: Full=Metallothionein-like protein type 2 gi|747906|emb|CAA54471.1| metallothionein [Vicia faba] gi|47076862|dbj|BAD18381.1| type 2 metallothionein [Vicia faba] gi|205277594|gb|ACI02064.1| metallothionein [Vicia faba] Length = 77 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +2 Query: 149 EMMTAGAENDGCKCGANCTCDPCTCK 226 E GAENDGCKCGANCTC+PCTCK Sbjct: 52 ESAEMGAENDGCKCGANCTCNPCTCK 77 >dbj|BAF35950.1| metallothionein [Coptis japonica] Length = 81 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 Query: 140 KGSEMMTAGAENDGCKCGANCTCDPCTCK 226 +GSEM + GAENDGC+CGANCTC+PC CK Sbjct: 54 EGSEM-SVGAENDGCQCGANCTCNPCNCK 81 >tpg|DAA53462.1| TPA: putative metallothionein famil protein, partial [Zea mays] Length = 122 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 134 STKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 ST G E AGAEN GCKCGA+CTCDPCTCK Sbjct: 93 STGGFEA-AAGAENGGCKCGASCTCDPCTCK 122 >gb|ACG34277.1| metallothionein-like protein type 2 [Zea mays] Length = 78 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 134 STKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 ST G E AGAEN GCKCGA+CTCDPCTCK Sbjct: 49 STGGFEA-AAGAENGGCKCGASCTCDPCTCK 78 >gb|ACG33636.1| metallothionein-like protein type 2 [Zea mays] Length = 90 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 134 STKGSEMMTAGAENDGCKCGANCTCDPCTCK 226 ST G E AGAEN GCKCGA+CTCDPCTCK Sbjct: 61 STGGFEA-AAGAENGGCKCGASCTCDPCTCK 90