BLASTX nr result
ID: Akebia27_contig00031098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031098 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKJ70900.1| hypothetical protein FPSE_08951 [Fusarium pseudog... 55 8e-06 >gb|EKJ70900.1| hypothetical protein FPSE_08951 [Fusarium pseudograminearum CS3096] Length = 85 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = +3 Query: 78 KVDPVEAGRKXXXXXXXXXXXXXXXXXXXXXDYKPTENDGLRKDGQPDGRVKGN 239 KVDP EAG + DYKPTE+DGLRKDG+PDGRVKGN Sbjct: 31 KVDPHEAGGQGGKTSGSGSSGGLESTSDDSGDYKPTEHDGLRKDGKPDGRVKGN 84