BLASTX nr result
ID: Akebia27_contig00031016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00031016 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212171.1| hypothetical protein PRUPE_ppa012526mg [Prun... 58 1e-06 ref|XP_004137247.1| PREDICTED: mitochondrial inner membrane prot... 58 2e-06 ref|XP_004979745.1| PREDICTED: mitochondrial inner membrane prot... 56 5e-06 ref|XP_004976723.1| PREDICTED: mitochondrial inner membrane prot... 56 5e-06 ref|XP_002300443.2| hypothetical protein POPTR_0001s38940g [Popu... 55 8e-06 >ref|XP_007212171.1| hypothetical protein PRUPE_ppa012526mg [Prunus persica] gi|462408036|gb|EMJ13370.1| hypothetical protein PRUPE_ppa012526mg [Prunus persica] Length = 166 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 369 RHFGPVPYGLLQGKAFCRIWPPDGFGSFD 283 R +G VPYGL+QGK FCR+WPPDGFGS D Sbjct: 138 RTYGAVPYGLIQGKVFCRVWPPDGFGSLD 166 >ref|XP_004137247.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cucumis sativus] gi|449483132|ref|XP_004156501.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cucumis sativus] Length = 161 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 369 RHFGPVPYGLLQGKAFCRIWPPDGFGSFDK 280 RHFGPVPYGL++GKAF R+WPPD FG D+ Sbjct: 132 RHFGPVPYGLIEGKAFLRVWPPDCFGRLDQ 161 >ref|XP_004979745.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Setaria italica] Length = 174 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 369 RHFGPVPYGLLQGKAFCRIWPPDGFGSFDKGM*P 268 RHFG VPYGL+ GK FCR+WP +GFGS D P Sbjct: 141 RHFGAVPYGLITGKIFCRVWPLEGFGSIDSNQSP 174 >ref|XP_004976723.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Setaria italica] Length = 174 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 369 RHFGPVPYGLLQGKAFCRIWPPDGFGSFDKGM*P 268 RHFG VPYGL+ GK FCR+WP +GFGS D P Sbjct: 141 RHFGAVPYGLITGKIFCRVWPLEGFGSIDSNQSP 174 >ref|XP_002300443.2| hypothetical protein POPTR_0001s38940g [Populus trichocarpa] gi|550349218|gb|EEE85248.2| hypothetical protein POPTR_0001s38940g [Populus trichocarpa] Length = 161 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -3 Query: 369 RHFGPVPYGLLQGKAFCRIWPPDGFGSF 286 RH+GPVPYGL+QGK F R+WPP FGSF Sbjct: 132 RHYGPVPYGLVQGKLFFRVWPPSSFGSF 159