BLASTX nr result
ID: Akebia27_contig00030478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00030478 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527513.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002527513.1| conserved hypothetical protein [Ricinus communis] gi|223533153|gb|EEF34911.1| conserved hypothetical protein [Ricinus communis] Length = 197 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +1 Query: 1 GTG-SVEGSAHRRAQSEFQAPPTFEFLEPRSGLEFLHSRSLRVDSVLSPSKMKDSK 165 G+G S+ GS+HRR +SEFQ PP E LE RS LE++ S SLR SV SP+ +SK Sbjct: 37 GSGDSINGSSHRRTRSEFQ-PPAMELLEQRSALEYVRSSSLRKRSVNSPTVASESK 91