BLASTX nr result
ID: Akebia27_contig00030052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00030052 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS83514.1| hypothetical protein PFICI_05390 [Pestalotiopsis ... 62 1e-07 gb|EON98858.1| putative endoplasmic reticulum protein [Togninia ... 59 7e-07 gb|EMR69836.1| putative endoplasmic reticulum protein [Eutypa la... 58 1e-06 ref|XP_001223621.1| hypothetical protein CHGG_04407 [Chaetomium ... 55 8e-06 ref|XP_003652880.1| hypothetical protein THITE_2170318 [Thielavi... 55 8e-06 >gb|ETS83514.1| hypothetical protein PFICI_05390 [Pestalotiopsis fici W106-1] Length = 280 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 3 QVWDGVKGGARQFHDVTDVGKYINGNTVPKKTS 101 QVWDGVK G RQFHDVTD+ KY NG VPKKTS Sbjct: 248 QVWDGVKSGGRQFHDVTDISKYTNGGAVPKKTS 280 >gb|EON98858.1| putative endoplasmic reticulum protein [Togninia minima UCRPA7] Length = 299 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 3 QVWDGVKGGARQFHDVTDVGKYINGNTVPKKTS 101 QVW+GVKGGARQFH TDV K++NG VPKKTS Sbjct: 267 QVWEGVKGGARQFHSATDVNKHLNGAAVPKKTS 299 >gb|EMR69836.1| putative endoplasmic reticulum protein [Eutypa lata UCREL1] Length = 283 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = +3 Query: 3 QVWDGVKGGARQFHDVTDVGKYI-NGNTVPKKTS 101 QVWDGVK GARQFH VTD+ KY+ NG+ VPKKTS Sbjct: 250 QVWDGVKNGARQFHSVTDISKYVNNGSAVPKKTS 283 >ref|XP_001223621.1| hypothetical protein CHGG_04407 [Chaetomium globosum CBS 148.51] gi|88180320|gb|EAQ87788.1| hypothetical protein CHGG_04407 [Chaetomium globosum CBS 148.51] Length = 287 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 3 QVWDGVKGGARQFHDVTDVGKYINGNTVPKKTS 101 QVWDGVK ARQFH TDV KY+NG PKKTS Sbjct: 255 QVWDGVKSTARQFHGATDVNKYVNGAAAPKKTS 287 >ref|XP_003652880.1| hypothetical protein THITE_2170318 [Thielavia terrestris NRRL 8126] gi|347000142|gb|AEO66544.1| hypothetical protein THITE_2170318 [Thielavia terrestris NRRL 8126] Length = 287 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 3 QVWDGVKGGARQFHDVTDVGKYINGNTVPKKTS 101 Q WDGVKG ARQFH TDV KY+NG PKKTS Sbjct: 255 QFWDGVKGTARQFHAATDVNKYVNGAAAPKKTS 287