BLASTX nr result
ID: Akebia27_contig00029635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00029635 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF76434.1| hypothetical protein EPUS_07314 [Endocarpon pusil... 56 5e-06 gb|EON63792.1| hypothetical protein W97_03020 [Coniosporium apol... 56 5e-06 ref|XP_003296184.1| hypothetical protein PTT_05285 [Pyrenophora ... 56 6e-06 ref|XP_001932298.1| RNP domain containing protein [Pyrenophora t... 56 6e-06 >gb|ERF76434.1| hypothetical protein EPUS_07314 [Endocarpon pusillum Z07020] Length = 496 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 PLGLSYVKYTNLSGGEDAMEGTEPTAGLTQDQIM 104 PLGL+YVKYTN+ GG DAMEGTE + GLTQDQIM Sbjct: 464 PLGLTYVKYTNIGGG-DAMEGTEASGGLTQDQIM 496 >gb|EON63792.1| hypothetical protein W97_03020 [Coniosporium apollinis CBS 100218] Length = 400 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 3 PLGLSYVKYTNLSGGEDAMEGTEPTAGLTQDQIM 104 PLGLSYVKY+N+S G DAMEGTE T GLTQDQIM Sbjct: 368 PLGLSYVKYSNVSNG-DAMEGTEATGGLTQDQIM 400 >ref|XP_003296184.1| hypothetical protein PTT_05285 [Pyrenophora teres f. teres 0-1] gi|311331880|gb|EFQ95720.1| hypothetical protein PTT_05285 [Pyrenophora teres f. teres 0-1] Length = 481 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 PLGLSYVKYTNLSGGEDAMEGTEPTAGLTQDQIM 104 PLGL+YVKYTNL G DAMEGTE T GLTQDQIM Sbjct: 449 PLGLAYVKYTNLGNG-DAMEGTEHTGGLTQDQIM 481 >ref|XP_001932298.1| RNP domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973904|gb|EDU41403.1| RNP domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 468 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 PLGLSYVKYTNLSGGEDAMEGTEPTAGLTQDQIM 104 PLGL+YVKYTNL G DAMEGTE T GLTQDQIM Sbjct: 436 PLGLAYVKYTNLGNG-DAMEGTEHTGGLTQDQIM 468