BLASTX nr result
ID: Akebia27_contig00029277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00029277 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439505.1| hypothetical protein CICLE_v10021507mg [Citr... 57 4e-06 ref|XP_006439504.1| hypothetical protein CICLE_v10021507mg [Citr... 57 4e-06 >ref|XP_006439505.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] gi|567894036|ref|XP_006439506.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] gi|557541767|gb|ESR52745.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] gi|557541768|gb|ESR52746.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 214 Score = 57.0 bits (136), Expect = 4e-06 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = -2 Query: 497 FDSSVHLQKCCLLTFGSRSGVCSSII*AL--NRLSLPLLDMRSASTSQTHRFKSNYFTSV 324 F V LQKCCL+ FGSRS +C+ I ++ +L+LP DM SAST +THRFK + F Sbjct: 146 FSLKVPLQKCCLINFGSRSCMCNFIEFSVRSKQLNLPHHDMCSASTFETHRFKFDCFAGG 205 Query: 323 VCPVF 309 P F Sbjct: 206 CTPFF 210 >ref|XP_006439504.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] gi|567894042|ref|XP_006439509.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] gi|557541766|gb|ESR52744.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] gi|557541771|gb|ESR52749.1| hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 202 Score = 57.0 bits (136), Expect = 4e-06 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = -2 Query: 497 FDSSVHLQKCCLLTFGSRSGVCSSII*AL--NRLSLPLLDMRSASTSQTHRFKSNYFTSV 324 F V LQKCCL+ FGSRS +C+ I ++ +L+LP DM SAST +THRFK + F Sbjct: 134 FSLKVPLQKCCLINFGSRSCMCNFIEFSVRSKQLNLPHHDMCSASTFETHRFKFDCFAGG 193 Query: 323 VCPVF 309 P F Sbjct: 194 CTPFF 198