BLASTX nr result
ID: Akebia27_contig00029165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00029165 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202836.1| hypothetical protein PRUPE_ppa014534mg [Prun... 57 3e-06 ref|XP_002322627.2| hypothetical protein POPTR_0016s03780g [Popu... 55 1e-05 >ref|XP_007202836.1| hypothetical protein PRUPE_ppa014534mg [Prunus persica] gi|462398367|gb|EMJ04035.1| hypothetical protein PRUPE_ppa014534mg [Prunus persica] Length = 48 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = -3 Query: 118 MAMPLGMALWLTKMVWMAMCEWISSCMTVAREIARAIRT 2 MAMP M W+ KMVW+A+ W+SSC+TVA E+A +IRT Sbjct: 1 MAMPWAMTFWMAKMVWLAVTGWVSSCLTVADEVAGSIRT 39 >ref|XP_002322627.2| hypothetical protein POPTR_0016s03780g [Populus trichocarpa] gi|550320760|gb|EEF04388.2| hypothetical protein POPTR_0016s03780g [Populus trichocarpa] Length = 48 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -3 Query: 118 MAMPLGMALWLTKMVWMAMCEWISSCMTVAREIARAIRT 2 MA P MALW+ MVW+A+ W+SSC+TVA E+A ++RT Sbjct: 1 MAFPWSMALWMANMVWVALIGWVSSCLTVADELASSLRT 39