BLASTX nr result
ID: Akebia27_contig00028635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00028635 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283389.2| PREDICTED: telomere repeat-binding protein 5... 62 6e-08 emb|CBI16113.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002313432.2| telomere-binding family protein [Populus tri... 62 1e-07 ref|XP_007208711.1| hypothetical protein PRUPE_ppa002403mg [Prun... 62 1e-07 gb|ACH81293.1| putative double-strand telomere binding protein 2... 59 7e-07 ref|XP_007206321.1| hypothetical protein PRUPE_ppa002522mg [Prun... 59 9e-07 ref|XP_002270720.2| PREDICTED: telomere repeat-binding protein 5... 58 1e-06 ref|XP_003530208.1| PREDICTED: telomere repeat-binding protein 5... 58 1e-06 emb|CBI30542.3| unnamed protein product [Vitis vinifera] 58 1e-06 ref|XP_006488345.1| PREDICTED: telomere repeat-binding protein 5... 58 2e-06 ref|XP_006488343.1| PREDICTED: telomere repeat-binding protein 5... 58 2e-06 ref|XP_006424854.1| hypothetical protein CICLE_v10027927mg [Citr... 58 2e-06 ref|XP_006424852.1| hypothetical protein CICLE_v10027927mg [Citr... 58 2e-06 ref|XP_006424849.1| hypothetical protein CICLE_v10027927mg [Citr... 58 2e-06 ref|XP_002534561.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_004241222.1| PREDICTED: telomere repeat-binding protein 5... 57 2e-06 ref|XP_004241221.1| PREDICTED: telomere repeat-binding protein 5... 57 2e-06 ref|XP_002299868.2| hypothetical protein POPTR_0001s24840g [Popu... 57 3e-06 gb|EYU18988.1| hypothetical protein MIMGU_mgv1a002859mg [Mimulus... 56 4e-06 ref|XP_006590983.1| PREDICTED: telomere repeat-binding protein 1... 56 4e-06 >ref|XP_002283389.2| PREDICTED: telomere repeat-binding protein 5-like [Vitis vinifera] Length = 696 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQKRLDYGFNGYQVPA P+A+RS+ RG ++KVEDN M Sbjct: 1 MVLQKRLDYGFNGYQVPATPRATRSARRRGLFRKKVEDNQM 41 >emb|CBI16113.3| unnamed protein product [Vitis vinifera] Length = 646 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQKRLDYGFNGYQVPA P+A+RS+ RG ++KVEDN M Sbjct: 1 MVLQKRLDYGFNGYQVPATPRATRSARRRGLFRKKVEDNQM 41 >ref|XP_002313432.2| telomere-binding family protein [Populus trichocarpa] gi|550330967|gb|EEE87387.2| telomere-binding family protein [Populus trichocarpa] Length = 682 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP IP+A+RS+ RGS K+K E+N M Sbjct: 1 MVLQKRLDYGFNGYQVPPIPRATRSARRRGSFKKKHEENQM 41 >ref|XP_007208711.1| hypothetical protein PRUPE_ppa002403mg [Prunus persica] gi|462404353|gb|EMJ09910.1| hypothetical protein PRUPE_ppa002403mg [Prunus persica] Length = 676 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQKRLDYGFNGYQVPA P+A+RS+ RG+++++V+DN M Sbjct: 1 MVLQKRLDYGFNGYQVPATPRATRSARRRGAIRKRVDDNSM 41 >gb|ACH81293.1| putative double-strand telomere binding protein 2 [Carica papaya] Length = 635 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQ RL+YGFNGYQVPA P+ASRS+ R S K+K EDN M Sbjct: 1 MVLQNRLEYGFNGYQVPATPRASRSTRRRSSFKKKPEDNQM 41 >ref|XP_007206321.1| hypothetical protein PRUPE_ppa002522mg [Prunus persica] gi|462401963|gb|EMJ07520.1| hypothetical protein PRUPE_ppa002522mg [Prunus persica] Length = 662 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDNHM 474 MVLQ+RLDYGFNGYQVP +P+ASRS+RG +K+K+E N + Sbjct: 1 MVLQRRLDYGFNGYQVPEVPRASRSARGRVPIKKKLEANQI 41 >ref|XP_002270720.2| PREDICTED: telomere repeat-binding protein 5-like [Vitis vinifera] Length = 664 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRS--SRGSLKRKVEDNHM 474 MVLQKRLDYGF+GYQVP +P+ASRS RGS K+K+ED+ + Sbjct: 1 MVLQKRLDYGFSGYQVPWVPRASRSPRGRGSSKKKLEDDRI 41 >ref|XP_003530208.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 [Glycine max] gi|571466186|ref|XP_006583591.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 [Glycine max] gi|571466188|ref|XP_006583592.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 [Glycine max] Length = 606 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/41 (65%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQKRL+YGFNGYQVP IP+ASRS+ RG++K+K ++N + Sbjct: 1 MVLQKRLNYGFNGYQVPVIPRASRSARGRGTIKKKPDNNQI 41 >emb|CBI30542.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRS--SRGSLKRKVEDNHM 474 MVLQKRLDYGF+GYQVP +P+ASRS RGS K+K+ED+ + Sbjct: 1 MVLQKRLDYGFSGYQVPWVPRASRSPRGRGSSKKKLEDDRI 41 >ref|XP_006488345.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 [Citrus sinensis] Length = 701 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP P+A+RS+R S K++ EDN M Sbjct: 1 MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQM 41 >ref|XP_006488343.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 [Citrus sinensis] gi|568870301|ref|XP_006488344.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 [Citrus sinensis] Length = 706 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP P+A+RS+R S K++ EDN M Sbjct: 1 MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQM 41 >ref|XP_006424854.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|568870307|ref|XP_006488347.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 [Citrus sinensis] gi|557526788|gb|ESR38094.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] Length = 694 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP P+A+RS+R S K++ EDN M Sbjct: 1 MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQM 41 >ref|XP_006424852.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|567864408|ref|XP_006424853.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|568870305|ref|XP_006488346.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 [Citrus sinensis] gi|557526786|gb|ESR38092.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|557526787|gb|ESR38093.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] Length = 699 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP P+A+RS+R S K++ EDN M Sbjct: 1 MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQM 41 >ref|XP_006424849.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|557526783|gb|ESR38089.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] Length = 631 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP P+A+RS+R S K++ EDN M Sbjct: 1 MVLQKRLDYGFNGYQVPYTPRATRSARKRCSFKKRAEDNQM 41 >ref|XP_002534561.1| conserved hypothetical protein [Ricinus communis] gi|223525029|gb|EEF27822.1| conserved hypothetical protein [Ricinus communis] Length = 688 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRS--SRGSLKRKVEDN 468 MVLQKRLDYGFNGYQVP P+A+RS RGS K+KVE++ Sbjct: 1 MVLQKRLDYGFNGYQVPPTPRATRSVRRRGSFKKKVEES 39 >ref|XP_004241222.1| PREDICTED: telomere repeat-binding protein 5-like isoform 2 [Solanum lycopersicum] Length = 691 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRS--SRGSLKRKVEDN 468 MVLQKRLDYGFNGYQVP IP+A+RS RG +KRK + N Sbjct: 1 MVLQKRLDYGFNGYQVPPIPRATRSVRRRGIIKRKADGN 39 >ref|XP_004241221.1| PREDICTED: telomere repeat-binding protein 5-like isoform 1 [Solanum lycopersicum] Length = 700 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRS--SRGSLKRKVEDN 468 MVLQKRLDYGFNGYQVP IP+A+RS RG +KRK + N Sbjct: 1 MVLQKRLDYGFNGYQVPPIPRATRSVRRRGIIKRKADGN 39 >ref|XP_002299868.2| hypothetical protein POPTR_0001s24840g [Populus trichocarpa] gi|550348110|gb|EEE84673.2| hypothetical protein POPTR_0001s24840g [Populus trichocarpa] Length = 720 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSS--RGSLKRKVEDNHM 474 MVLQKRLDYGFNGYQVP +P+A+RS+ R S K+K E+N M Sbjct: 1 MVLQKRLDYGFNGYQVPHMPRATRSARRRRSFKKKHEENQM 41 >gb|EYU18988.1| hypothetical protein MIMGU_mgv1a002859mg [Mimulus guttatus] Length = 630 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRG--SLKRKVEDN 468 MVLQKRLDYGFNGYQVP IP+A+RS+R K+K +DN Sbjct: 1 MVLQKRLDYGFNGYQVPPIPRAARSARRRCMFKKKADDN 39 >ref|XP_006590983.1| PREDICTED: telomere repeat-binding protein 1-like isoform X2 [Glycine max] gi|571488603|ref|XP_006590984.1| PREDICTED: telomere repeat-binding protein 1-like isoform X3 [Glycine max] Length = 690 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +1 Query: 358 MVLQKRLDYGFNGYQVPAIPKASRSSRGSLK-RKVEDN 468 MVLQKRL+YGFNGYQ PA+P+ASRS+R K R+ EDN Sbjct: 1 MVLQKRLEYGFNGYQAPAMPRASRSTRRRAKFRRAEDN 38