BLASTX nr result
ID: Akebia27_contig00028109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00028109 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278220.1| PREDICTED: uncharacterized protein LOC100260... 58 1e-06 ref|XP_007020840.1| Expression of the gene is downregulated in t... 58 2e-06 >ref|XP_002278220.1| PREDICTED: uncharacterized protein LOC100260689 [Vitis vinifera] Length = 125 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 261 RMDVQGSSVEQILAQLVNVSDHCNTNQRSWRPVLQSIPEMN 139 ++DVQG +V Q+L L+NVSD T QRSWRP LQSIPE+N Sbjct: 85 KVDVQGLTVHQVLQHLMNVSDRFETEQRSWRPALQSIPEVN 125 >ref|XP_007020840.1| Expression of the gene is downregulated in the presence of paraquat, putative [Theobroma cacao] gi|508720468|gb|EOY12365.1| Expression of the gene is downregulated in the presence of paraquat, putative [Theobroma cacao] Length = 127 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 261 RMDVQGSSVEQILAQLVNVSDHCNTNQRSWRPVLQSIPEMN 139 R+DV+ SV+Q+LAQL+NV + T+QRSWRP LQSIPE+N Sbjct: 87 RVDVKELSVQQVLAQLINVRNQYETSQRSWRPALQSIPEVN 127