BLASTX nr result
ID: Akebia27_contig00028054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00028054 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31155.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002265744.1| PREDICTED: RING finger and transmembrane dom... 64 3e-08 emb|CAN82461.1| hypothetical protein VITISV_005516 [Vitis vinifera] 64 3e-08 ref|XP_007207444.1| hypothetical protein PRUPE_ppa005202mg [Prun... 57 2e-06 ref|XP_004302509.1| PREDICTED: RING finger and transmembrane dom... 57 3e-06 gb|EXC35225.1| RING finger and transmembrane domain-containing p... 56 6e-06 ref|XP_004249023.1| PREDICTED: RING finger and transmembrane dom... 55 8e-06 >emb|CBI31155.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 126 FGLQFSTANFIQAPLSALLEYSGILRARSSHQETEGLINGGV 1 +G+Q S +N IQAPLSALLEYSG+LR RSSHQETE LI G V Sbjct: 22 YGMQLSASNIIQAPLSALLEYSGLLRGRSSHQETESLIYGSV 63 >ref|XP_002265744.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Vitis vinifera] Length = 462 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 126 FGLQFSTANFIQAPLSALLEYSGILRARSSHQETEGLING 7 +G+Q S +N IQAPLSALLEYSG+LR RSSHQETE LI G Sbjct: 22 YGMQLSASNIIQAPLSALLEYSGLLRGRSSHQETESLIYG 61 >emb|CAN82461.1| hypothetical protein VITISV_005516 [Vitis vinifera] Length = 253 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 126 FGLQFSTANFIQAPLSALLEYSGILRARSSHQETEGLING 7 +G+Q S +N IQAPLSALLEYSG+LR RSSHQETE LI G Sbjct: 65 YGMQLSASNIIQAPLSALLEYSGLLRGRSSHQETESLIYG 104 >ref|XP_007207444.1| hypothetical protein PRUPE_ppa005202mg [Prunus persica] gi|462403086|gb|EMJ08643.1| hypothetical protein PRUPE_ppa005202mg [Prunus persica] Length = 472 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 111 STANFIQAPLSALLEYSGILRARSSHQETEGLING 7 S +N IQAPLSALLEYSG+LR RS+HQE E LING Sbjct: 27 SASNIIQAPLSALLEYSGLLRGRSNHQEAESLING 61 >ref|XP_004302509.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Fragaria vesca subsp. vesca] Length = 470 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 111 STANFIQAPLSALLEYSGILRARSSHQETEGLING 7 S +NFIQAPLSALLEYSG+LR RS HQE E LI G Sbjct: 28 SASNFIQAPLSALLEYSGLLRGRSGHQEAESLIGG 62 >gb|EXC35225.1| RING finger and transmembrane domain-containing protein 2 [Morus notabilis] Length = 481 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -1 Query: 126 FGLQFSTANFIQAPLSALLEYSGILR--ARSSHQETEGLINGGV 1 FGL S +N QAPLSALLEYSGILR RS+HQETEGLI+G V Sbjct: 34 FGL-LSASNVFQAPLSALLEYSGILRGGGRSNHQETEGLISGRV 76 >ref|XP_004249023.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Solanum lycopersicum] Length = 477 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 123 GLQFSTANFIQAPLSALLEYSGILRARSSHQETEGLIN 10 G+Q S AN ++PLS LLEYSGILR RSSH ET+ LIN Sbjct: 31 GVQLSAANLFRSPLSTLLEYSGILRTRSSHTETDSLIN 68