BLASTX nr result
ID: Akebia27_contig00028014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00028014 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citr... 67 2e-09 ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citr... 67 2e-09 ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobr... 67 2e-09 gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tab... 67 2e-09 gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana ta... 67 2e-09 gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] 67 2e-09 ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|36581... 67 2e-09 ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tubero... 67 2e-09 dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipo... 67 2e-09 ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Popu... 67 2e-09 gb|ABM53872.1| IAA4 [Cestrum elegans] 67 2e-09 gb|ABH01143.1| auxin-regulated protein [Populus tomentosa] 67 2e-09 gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremul... 67 2e-09 ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum] gi|36581... 67 3e-09 ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum... 67 3e-09 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis] 66 4e-09 ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutr... 66 4e-09 ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [A... 66 4e-09 ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prun... 66 4e-09 dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila] 66 4e-09 >ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina] gi|568835236|ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus sinensis] gi|557535045|gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina] Length = 245 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 214 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 245 >ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citrus clementina] gi|568835238|ref|XP_006471685.1| PREDICTED: auxin-responsive protein IAA16-like isoform X2 [Citrus sinensis] gi|557535044|gb|ESR46162.1| hypothetical protein CICLE_v10002290mg [Citrus clementina] Length = 221 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 190 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 221 >ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] gi|508719172|gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] Length = 249 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 218 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum] Length = 240 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 209 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum] Length = 220 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 189 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 220 >gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] Length = 246 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 215 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 246 >ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|365818541|gb|AEX00359.1| IAA16 [Solanum lycopersicum] Length = 251 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 220 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251 >ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum] gi|256857790|gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum] Length = 249 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 218 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil] Length = 225 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 194 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 225 >ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa] gi|118484744|gb|ABK94241.1| unknown [Populus trichocarpa] gi|550338168|gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa] Length = 250 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 219 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 250 >gb|ABM53872.1| IAA4 [Cestrum elegans] Length = 149 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 118 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 149 >gb|ABH01143.1| auxin-regulated protein [Populus tomentosa] Length = 258 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 220 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251 >gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides] Length = 249 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 218 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum] gi|365818525|gb|AEX00351.1| IAA7 [Solanum lycopersicum] Length = 218 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 100 RMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 +MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 186 QMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 218 >ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum] gi|117573699|gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum] Length = 213 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 100 RMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 +MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 181 QMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 213 >gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis] Length = 257 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR+ Sbjct: 226 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRT 257 >ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum] gi|557109305|gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum] Length = 234 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 100 RMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 +MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNRS Sbjct: 202 KMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 234 >ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda] gi|548841373|gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda] Length = 238 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSC+RLRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 207 MFVDSCRRLRIMKGSEAIGLAPRAVEKCKNRS 238 >ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica] gi|462420746|gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica] Length = 239 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 97 MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNRS Sbjct: 208 MFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 239 >dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila] Length = 234 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 100 RMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 2 +MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNRS Sbjct: 202 KMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 234