BLASTX nr result
ID: Akebia27_contig00027873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027873 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC92761.1| hypothetical protein BAUCODRAFT_125737 [Baudoinia... 70 2e-10 gb|EQB59228.1| hypothetical protein CGLO_00418 [Colletotrichum g... 55 1e-05 >gb|EMC92761.1| hypothetical protein BAUCODRAFT_125737 [Baudoinia compniacensis UAMH 10762] Length = 88 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 2/61 (3%) Frame = +1 Query: 76 MPRDGSGAGDNAIEAGE--TRGTKC*FRR*QGKASSGVDRSNKAAPMPEVEKGDSIEGMN 249 MPRDGSGAGDNA+E G+ G +SSGVDRS+KAAP PEVEKGDS+EG+N Sbjct: 1 MPRDGSGAGDNAVEQGQDLVHGAG----ENDAPSSSGVDRSSKAAPPPEVEKGDSLEGLN 56 Query: 250 A 252 A Sbjct: 57 A 57 >gb|EQB59228.1| hypothetical protein CGLO_00418 [Colletotrichum gloeosporioides Cg-14] Length = 75 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 2/61 (3%) Frame = +1 Query: 76 MPRDGSGAGDNAIEAGE--TRGTKC*FRR*QGKASSGVDRSNKAAPMPEVEKGDSIEGMN 249 MPRDGSGA DNA+EAG G S VDR++K APMPE+EKG +I+G + Sbjct: 1 MPRDGSGASDNAVEAGHDIVHGAGA-------VKDSHVDRADKTAPMPEIEKGLAIDGKD 53 Query: 250 A 252 A Sbjct: 54 A 54