BLASTX nr result
ID: Akebia27_contig00027450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027450 (1013 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] 45 1e-06 >emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] Length = 177 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 23/48 (47%), Positives = 28/48 (58%) Frame = +3 Query: 849 LFIHCRVAHHIWLHFLSLFGIMGCFPSSVKSALESWLSWDGAFSLSKR 992 L +HC +W F SLFG++ FPSSVK L LSW+G F KR Sbjct: 90 LLLHCVKTRALWEVFFSLFGVLWVFPSSVKETL---LSWNGFFVGKKR 134 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 782 RRGFISPNRCCMCRSQAETVDHLI 853 +RG+ PNRC +C S E++DHL+ Sbjct: 68 KRGWALPNRCYLCHSNEESIDHLL 91