BLASTX nr result
ID: Akebia27_contig00027303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027303 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855641.1| hypothetical protein AMTR_s00044p00106410 [A... 55 8e-06 >ref|XP_006855641.1| hypothetical protein AMTR_s00044p00106410 [Amborella trichopoda] gi|548859428|gb|ERN17108.1| hypothetical protein AMTR_s00044p00106410 [Amborella trichopoda] Length = 653 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -1 Query: 150 MTGGSLGQRTSSYGSLQQHQQNSVVLLPIQTSPVIVRKPSKMPLSGSREK 1 MTGGSLG RT SYGSL + S L SP +RKPSKM +SGSREK Sbjct: 1 MTGGSLGLRTGSYGSLHDQSKISPGLPVPNNSPNFIRKPSKMLISGSREK 50